Align alpha-glucosidase (EC 3.2.1.20) (characterized)
to candidate N515DRAFT_3389 N515DRAFT_3389 alpha-glucosidase
Query= BRENDA::P21517 (604 letters) >lcl|FitnessBrowser__Dyella79:N515DRAFT_3389 N515DRAFT_3389 alpha-glucosidase Length = 673 Score = 305 bits (781), Expect = 4e-87 Identities = 201/566 (35%), Positives = 279/566 (49%), Gaps = 34/566 (6%) Query: 48 VPMHKQRSQPQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPARLEQ 107 V MH + P W+ + SS + + Y F+L W+ G S P+ + Sbjct: 97 VAMHWASNDPTGTFDYWQGTVPASSSE--KYYRFQLNDGSASAWYNAAGTSSSEPSSGDF 154 Query: 108 FAVDVPDIG-PQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWDEPVT 166 + + P P W + + YQIFPDRF Q Y + GQ W V Sbjct: 155 YLI--PGFKTPDWMKNGVIYQIFPDRFYNGDTSNDVQTGQYSY--GGQSTQKVAWGGSVF 210 Query: 167 AQAGGST---FYGGDLDGISEKLPYLKK-LGVTALYLNPVFKAPSVHKYDTEDYRHVDPQ 222 A GS F+GGDL G+ +KL Y+K+ LG +YLNPVF +P+ HKYDTEDY HVDP Sbjct: 211 ATGSGSNNLVFFGGDLAGVDQKLGYIKQTLGANIVYLNPVFTSPTNHKYDTEDYYHVDPA 270 Query: 223 FGGDGALLRL----RHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNR-GTGGACHNPESPW 277 FG + L L +T ++LDGVFNH+GD+ WFDR+N T GA + S W Sbjct: 271 FGSNTTLQTLIADVHASTNGPKGYVMLDGVFNHTGDTSQWFDRYNWWSTQGAYESTSSTW 330 Query: 278 RDWYSFSD-DGTALDWLGYASLPKLDY--QSESLVNEIYRGEDSIVRHWLKAPWNMDGWR 334 +Y+F GT + GY+++PKLDY ++ N+IY S+V+ WL +P+ +DGWR Sbjct: 331 YGYYTFQQWPGTYSSFYGYSTMPKLDYGASGSAVRNQIYGSTSSVVKTWLSSPYGIDGWR 390 Query: 335 LDVVHML---GEAGGARNNMQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVE-DAA 390 LD + G G N Q +A + A K A I+GE +G+A W E D+A Sbjct: 391 LDAPQYIDAGGNNGSDAINHQIMAELRTAVKAVNANAEILGEFWGNANPWTGNGKEWDSA 450 Query: 391 MNYRGFTFPLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTA 450 +NY GFT P+ ++ D S + I A +W+ RA Q M N L SHD Sbjct: 451 LNYDGFTQPVSEWITGYDYSGNAASIPASQFDSWLHGTRANYPGNVQQTMANFLSSHDIQ 510 Query: 451 RFKTLLGRDIARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDTAL 510 RF G DI + LA+++ T+ G P IYYGDE G+ G NDP R+ F W A Sbjct: 511 RFAQRAGGDIWKTYLALIFQMTYVGTPTIYYGDEYGMQGGNDPDNRRTFDWTQGSTTNAA 570 Query: 511 FALYQRMIALRKKSQALRHGGCQVLYAEDN--VVVFVRVLNQQRVLVAINR-GEACEVVL 567 AL Q++IA+R + ALR G L +D+ + + R RV VA+N A V + Sbjct: 571 VALTQKLIAIRNQYAALRTGSFMSLLTDDSNKLYAYGRFDASHRVAVALNNDSTAHSVTV 630 Query: 568 PASPFLNAVQWQCKEGHGQLTDGILA 593 P WQ +G +L+ Sbjct: 631 PV--------WQLSMANGSAVTDLLS 648 Lambda K H 0.322 0.138 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1226 Number of extensions: 74 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 604 Length of database: 673 Length adjustment: 38 Effective length of query: 566 Effective length of database: 635 Effective search space: 359410 Effective search space used: 359410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory