Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 131 bits (329), Expect = 2e-35 Identities = 69/185 (37%), Positives = 105/185 (56%) Query: 15 EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGI 74 +V + ++L + +G+F+ L+GPSG GKTT L +I GL+ P+ G I +G + + G Sbjct: 22 KVEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGSIGVGGQRIDQLGAGA 81 Query: 75 FVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLN 134 + ++ VFQ Y L P +T N+ PL L K+ + + +L+GL E + Sbjct: 82 LAKWRAANVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQRRKNAAIALQLVGLDERSS 141 Query: 135 RKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTI 194 KP ELSGGQ+QRVA+ RAIV P + + DEP +LD + + L+ L R+ G T + Sbjct: 142 HKPSELSGGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSAEDVLGLLRTLNREHGKTIV 201 Query: 195 YVTHD 199 VTHD Sbjct: 202 MVTHD 206 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 230 Length adjustment: 26 Effective length of query: 346 Effective length of database: 204 Effective search space: 70584 Effective search space used: 70584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory