Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Alt a 8; EC 1.1.1.138 (characterized)
to candidate N515DRAFT_2873 N515DRAFT_2873 3-oxoacyl-[acyl-carrier-protein] reductase
Query= SwissProt::P0C0Y4 (266 letters) >FitnessBrowser__Dyella79:N515DRAFT_2873 Length = 247 Score = 117 bits (292), Expect = 3e-31 Identities = 82/246 (33%), Positives = 124/246 (50%), Gaps = 7/246 (2%) Query: 20 KVVIVTGASGPTGIGTEAARGCAEYGAD-LAITYNSRAEGAEKNAKEMSEKYGVKVKAYK 78 ++ IVTG G G+GTE R A G +A +RA+ E+++ G V+ Sbjct: 3 RIAIVTGGIG--GLGTEICRQLALAGRQVIAADLPARADRVAAFQAELADLDGA-VRFEP 59 Query: 79 CQVNEYAQCEKLVQDVIKDFGKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTFNC 138 V+++A C +L+ V G+VDV + AG T D + + W E+++ +L G FN Sbjct: 60 VDVSDFASCSELIARVEAAHGRVDVLVNAAGITRDTTLRKMDPQHWQELMRVNLDGVFNM 119 Query: 139 ARAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAGCIHLAKSLANEW-RDFAR 197 R V R G +V SS++G F Q +Y AKAG +LA E R Sbjct: 120 CRHVVEGMSARGFGRIVNLSSVNGQTGQF--GQTNYAAAKAGVHGFGMALARETARKGVT 177 Query: 198 VNSISPGYIDTGLSDFVPQDIQKLWHSMIPMGRDAKATELKGAYVYFASDASSYCTGSDL 257 VN++SPGY DT L VP +I+ IP+GR ++ A + A+D + Y TG++L Sbjct: 178 VNTVSPGYCDTPLVARVPAEIRAQILEDIPVGRLGSPADIARAVCFLAADDAGYITGANL 237 Query: 258 LIDGGY 263 ++GGY Sbjct: 238 PVNGGY 243 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 247 Length adjustment: 24 Effective length of query: 242 Effective length of database: 223 Effective search space: 53966 Effective search space used: 53966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory