Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 116 bits (291), Expect = 8e-31 Identities = 79/241 (32%), Positives = 121/241 (50%), Gaps = 20/241 (8%) Query: 19 GIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGRIVDGEAIFLGKDLLK 78 G A+D S + +GE + ++G SGSGKS SLLR++ G+ + G DLL Sbjct: 13 GAFAALDDFSLDIAEGEFVALLGPSGSGKS----SLLRILAGLDDPDRGDVLRDGTDLLA 68 Query: 79 LNKEELRNIRGKDISIIFQN----PMTSLNPIIRVGIQVMEPIIWHRLMKNEEARERAIE 134 L + +DI ++FQ+ P ++ I G++V R + R + Sbjct: 69 LPAQR------RDIGLVFQHYALFPHMTVADNIAFGLRVRPRA---RRPSRRDIAARVED 119 Query: 135 LLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTTALDVTIQAQIM 194 LL RV + E +R YP Q SGG RQRV +A ALA P LL+ DEP ALD ++ + Sbjct: 120 LLRRVQLEELGRR---YPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLR 176 Query: 195 ELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEILKTPLHPYTKGL 254 L++L+ G++ + +THD A DR++ M G+I + EI + P P+ G Sbjct: 177 VWLRDLQRSLGLTTVLVTHDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGF 236 Query: 255 L 255 + Sbjct: 237 V 237 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 384 Length adjustment: 29 Effective length of query: 295 Effective length of database: 355 Effective search space: 104725 Effective search space used: 104725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory