Align fructokinase (EC 2.7.1.4) (characterized)
to candidate N515DRAFT_2221 N515DRAFT_2221 2-dehydro-3-deoxygluconokinase
Query= BRENDA::O04897 (347 letters) >FitnessBrowser__Dyella79:N515DRAFT_2221 Length = 311 Score = 132 bits (332), Expect = 1e-35 Identities = 104/313 (33%), Positives = 152/313 (48%), Gaps = 20/313 (6%) Query: 28 VVCFGEMLIDFIPTVAGVSLAEAPAFEKAPGGAPANVAVCISKLGGSSAFIGKVGDDEFG 87 ++ FGE L +F T AG + A+ GG +N + ++ G S +I GDD FG Sbjct: 6 ILSFGEPLAEFNQTQAG-----SAAWRLGYGGDTSNFCIAAARQGASVDYISATGDDRFG 60 Query: 88 RMLADILKQNNVDNSGMRFDHDARTALAFITLTAEGEREFVFFRNPSADMLLRESELDVD 147 + L D+ + V +S +R D A T + F++ A G F + R SA + L Sbjct: 61 QGLRDLWQAEGVGHSHVRTDPQAPTGVYFVSHDASG-HHFDYLRAGSAASRYVPAYLPGQ 119 Query: 148 LIKKATIFHYGSISL-IDEPCRSTHLAAMDIAKRSGSILSYDPNLRLPLWPSEDAARSGI 206 I A H ISL I + L AM A+ +G ++S+D NLRL LWP AR+ + Sbjct: 120 AIASARALHLSGISLAISQDACDAGLEAMAQARAAGVMVSFDTNLRLRLWPLA-RARAVM 178 Query: 207 MSVWNLADIIKISEDEISFLTGADDPNDDEVVLKRLFHPNLKLLLVTEGSAGCRYYTKEF 266 L D+ S D+I T D ++ + +L L ++L+ + G+ GC T E Sbjct: 179 REALRLCDLCLPSWDDI---TAVLDCHEPDAILDTLLDCGIELVALKMGARGCYVATPES 235 Query: 267 KGRVNSIKVKAVDTTGAGDAFTGG-VLKCLASDASLYQDEKRLREAIFFANVCAALTVTG 325 + V V AVD TGAGD F G V + +A D ++ A +ANV AAL+ TG Sbjct: 236 RILVPPHAVDAVDATGAGDCFGGAFVARLVAGDDAV--------AAARYANVAAALSTTG 287 Query: 326 RGGIPSLPTQDAV 338 G I S+P +AV Sbjct: 288 YGAIASIPRAEAV 300 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 311 Length adjustment: 28 Effective length of query: 319 Effective length of database: 283 Effective search space: 90277 Effective search space used: 90277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory