Align Inositol transport system ATP-binding protein (characterized)
to candidate N515DRAFT_2413 N515DRAFT_2413 simple sugar transport system ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__Dyella79:N515DRAFT_2413 Length = 505 Score = 152 bits (385), Expect = 1e-41 Identities = 89/250 (35%), Positives = 145/250 (58%), Gaps = 4/250 (1%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 +++ +G+ K FG+ +AL GV + + GE H L+G NGAGKST IK ++GV +P +G + Sbjct: 12 VLQARGLGKRFGATLALDGVDLALRAGEVHALMGQNGAGKSTLIKLLTGVERPDRGSVEL 71 Query: 67 EGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANR 126 +G+ + + P +A GI TV+Q + + P +SV+ N + G P R+ L++ D Sbjct: 72 DGRVIAPSTPMEAQRDGIGTVYQEVNLCPNLSVAENLYAGRYPRRR--RLRMIDWRQVRD 129 Query: 127 ITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTAN 186 +R++ + L D +G+ RQ VAIARA+ A+VLILDEPTS+L + Sbjct: 130 GARSLLRQLHLEL-DVDAPLGSYPVAIRQMVAIARALGVSARVLILDEPTSSLDEGEVRE 188 Query: 187 VLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMAG 246 + I ++R++G+A++F+TH + AV DR TVL G +G D+ L + M Sbjct: 189 LFRVIAQLRERGMAILFVTHFLDQVYAVSDRITVLRDGCRVGEYAVADLPPAALVNAMV- 247 Query: 247 GQELATLEGS 256 G++L T+ G+ Sbjct: 248 GRDLPTVAGA 257 Score = 72.8 bits (177), Expect = 1e-17 Identities = 62/244 (25%), Positives = 108/244 (44%), Gaps = 11/244 (4%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 P I QG+ G L V + V GE L G G+G++ + + G+ + +G++ Sbjct: 269 PAIDAQGL----GCRGKLHPVDLQVRRGEMLGLGGLLGSGRTELARLLFGLDRAERGELR 324 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHL---AMIPLMSVSRNFFMGNEPIRKIGPLKLFDHD 122 G+ + P DA+ G+A + ++ +SV N + + + + D Sbjct: 325 IGGERVELKHPADAVVRGLALCPEERKTDGIVAELSVRENIVLALQARQGWRGMSRARQD 384 Query: 123 YANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVR 182 + + ++ +GI + VG LSGG +Q V +AR + ++LILDEPT + V Sbjct: 385 ---ELARQLVQALGIKAADIETPVGLLSGGNQQKVMLARWLVTEPRLLILDEPTRGIDVA 441 Query: 183 QTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQD 242 ++A + + G+AV+FI+ DR V+ + G G A L Sbjct: 442 AKQELMAEVTRRAHAGMAVLFISAETGELTRWCDRIAVMRERRKAGELPGGSTEARVLA- 500 Query: 243 MMAG 246 M+AG Sbjct: 501 MIAG 504 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 261 Length of database: 505 Length adjustment: 29 Effective length of query: 232 Effective length of database: 476 Effective search space: 110432 Effective search space used: 110432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory