Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate N515DRAFT_2415 N515DRAFT_2415 simple sugar transport system permease protein
Query= TCDB::B8H230 (332 letters) >FitnessBrowser__Dyella79:N515DRAFT_2415 Length = 337 Score = 150 bits (379), Expect = 4e-41 Identities = 107/303 (35%), Positives = 166/303 (54%), Gaps = 20/303 (6%) Query: 29 ILFLLLLVAVFGAAN---ERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVAVGSL 85 ++ L+L VA+ GA FLT + LN+L + + I+AVGMTFVIL GGID++VG++ Sbjct: 28 LVTLVLFVAMAGAGGVLYHGFLTPQVFLNLLIDNAFLCIVAVGMTFVILAGGIDLSVGAV 87 Query: 86 LAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGM 145 +AF+++ A +V P IAL+++ G G G + + F+VTL GM Sbjct: 88 VAFSTVLLAELVQR--HGWPPLAAIALVLAVGTGFGAG--MGVLIQRFRLQPFVVTLAGM 143 Query: 146 TVWRGATLLLNDGGPISGFNDAYRWWGSGEILFLP--------VPVVIFALVAAAGHVAL 197 + RG L++ + + W S L LP V ++ V AAG + Sbjct: 144 FLARGVATLIS----VDSIDIDQPWLASVANLRLPLGGGSMLSVGALVALAVVAAGALLA 199 Query: 198 RYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAVAG 257 + +GR VYA+GG+ +ARL G+ VD VYA+ G A L+G + + + S + Sbjct: 200 GASSFGRTVYAIGGSESSARLMGLPVDATVVRVYALSGFCAALAGVVYTLYMLSGYSQHA 259 Query: 258 TGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVM-LHVTSYVQQVVIGLI 316 G EL IA+VVIGG L GGSG V GT+LG L++G++ +V ++S+ ++VIG + Sbjct: 260 LGLELDAIAAVVIGGTVLAGGSGYVLGTLLGVLVLGLIQTLIVFDGELSSWWTRIVIGAL 319 Query: 317 IVA 319 ++A Sbjct: 320 LLA 322 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 337 Length adjustment: 28 Effective length of query: 304 Effective length of database: 309 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory