Align scyllo-inosose 3-dehydrogenase; 2-keto-myo-inositol dehydrogenase; EC 1.1.1.- (characterized)
to candidate N515DRAFT_0211 N515DRAFT_0211 Threonine dehydrogenase
Query= SwissProt::Q9WYP3 (395 letters) >FitnessBrowser__Dyella79:N515DRAFT_0211 Length = 338 Score = 97.4 bits (241), Expect = 5e-25 Identities = 71/251 (28%), Positives = 109/251 (43%), Gaps = 21/251 (8%) Query: 39 EVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEFS 98 ++R EEVPEP+IEKPT+ II++ +CGSD+ + G P +GHE+ Sbjct: 11 DIRFEEVPEPKIEKPTDAIIRIAVTCVCGSDLWPYRGISPG--------SGPTRMGHEYC 62 Query: 99 GVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGA 158 G V E G A+ +F +G ++ C C G+ + C V A Sbjct: 63 GYVEEVG-SAVMAIKKGQFVVGSFATSDNT-----CPTCNIGYQSSCVQREF----VSQA 112 Query: 159 FAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVIL 218 + Y++V + E D + G L + +RPG V++ Sbjct: 113 QSPYLRVAHADGTLVATREAP---DASMVPGLLASSDVLGTGWYAADAARVRPGVTAVVV 169 Query: 219 GGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTNG 278 G G +GL AV K GA ++I+ R+ LA + GA ++ E V +++ T G Sbjct: 170 GDGAVGLLAVLSAKQMGAERIIVMSRHPARQKLALDFGATDIVAERGEEGVARIMELTRG 229 Query: 279 LGAKLFLEATG 289 LGA LE G Sbjct: 230 LGADSVLECVG 240 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 338 Length adjustment: 30 Effective length of query: 365 Effective length of database: 308 Effective search space: 112420 Effective search space used: 112420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory