Align phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate N515DRAFT_3052 N515DRAFT_3052 Phenylalanine 4-hydroxylase
Query= BRENDA::P30967 (297 letters) >FitnessBrowser__Dyella79:N515DRAFT_3052 Length = 297 Score = 367 bits (943), Expect = e-106 Identities = 174/268 (64%), Positives = 207/268 (77%), Gaps = 2/268 (0%) Query: 31 QPLDRYSAEDHATWATLYQRQCKLLPGRACDEFMEGLERLEVDADRVPDFNKLNQKLMAA 90 QP YS DH W TLY+RQ +LL GRAC EF++G+ER + + +P F LN+ L Sbjct: 29 QPWADYSQTDHEVWNTLYRRQRELLKGRACQEFLDGIERFGMGENGIPKFADLNKVLGET 88 Query: 91 TGWKIVAVPGLIPDDVFFEHLANRRFPVTWWLREPHQLDYLQEPDVFHDLFGHVPLLINP 150 TGW++VAV GL+PD+VFF+HLANRRFPV+WW+R P QLDYL EPD+FHDLFGHVPLL+NP Sbjct: 89 TGWELVAVEGLLPDEVFFDHLANRRFPVSWWIRRPDQLDYLSEPDLFHDLFGHVPLLLNP 148 Query: 151 VFADYLEAYGKGGVKAKALG--ALPMLARLYWYTVEFGLINTPAGMRIYGAGILSSKSES 208 VFADY++AYG+GG+KA +G AL L RLYWYTVEFGLINT GMRIYGAGI+SSK ES Sbjct: 149 VFADYMQAYGRGGMKAFGIGPEALMNLTRLYWYTVEFGLINTSEGMRIYGAGIVSSKGES 208 Query: 209 IYCLDSASPNRVGFDLMRIMNTRYRIDTFQKTYFVIDSFKQLFDATAPDFAPLYLQLADA 268 IYCLDSA+PNR+GF L R+MNTRYRIDTFQ+TYFVIDSF+QLFDAT PDF P+Y L Sbjct: 209 IYCLDSAAPNRIGFGLERVMNTRYRIDTFQQTYFVIDSFEQLFDATRPDFTPIYADLKTR 268 Query: 269 QPWGAGDVAPDDLVLNAGDRQGWADTED 296 + A DV D V G R+G+A D Sbjct: 269 EAHAAADVLDSDRVFTRGTREGFATDAD 296 Lambda K H 0.323 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 297 Length adjustment: 26 Effective length of query: 271 Effective length of database: 271 Effective search space: 73441 Effective search space used: 73441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_3052 N515DRAFT_3052 (Phenylalanine 4-hydroxylase)
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.2007870.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-117 377.6 0.0 1.4e-117 377.3 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 N515DRAFT_3052 Phenylalanine 4-h Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 N515DRAFT_3052 Phenylalanine 4-hydroxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 377.3 0.0 1.4e-117 1.4e-117 4 248 .] 27 274 .. 24 274 .. 0.97 Alignments for each domain: == domain 1 score: 377.3 bits; conditional E-value: 1.4e-117 TIGR01267 4 vaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwk 69 v+q++ ys+++h+vw+tl+ rq ll+grac+e+ldG+e++g+ + ip++ ++n++l ++tGw+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 27 VEQPWADYSQTDHEVWNTLYRRQRELLKGRACQEFLDGIERFGMGENGIPKFADLNKVLGETTGWE 92 689999************************************************************ PP TIGR01267 70 ivavpglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayG 135 +vav gl+p++vff+hlanrrfpv++++r p++ldyl epd+fhdlfGhvpll npvfad+++ayG lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 93 LVAVEGLLPDEVFFDHLANRRFPVSWWIRRPDQLDYLSEPDLFHDLFGHVPLLLNPVFADYMQAYG 158 ****************************************************************** PP TIGR01267 136 kkgvkakalgaa...llarlywytvefGlvetaaglriyGaGilsskkelvyaleskeplrvafdl 198 ++g+ka g + l+rlywytvefGl++t++g+riyGaGi+ssk e++y+l+s+ p+r++f l lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 159 RGGMKAFGIGPEalmNLTRLYWYTVEFGLINTSEGMRIYGAGIVSSKGESIYCLDSAAPNRIGFGL 224 ******98876544579************************************************* PP TIGR01267 199 levmrtryridklqkayfvlpslkrlfdaaqedfealvaeakdlkaldpa 248 ++vm+tryrid++q++yfv++s+++lfda+++df++++a++k +a+++a lcl|FitnessBrowser__Dyella79:N515DRAFT_3052 225 ERVMNTRYRIDTFQQTYFVIDSFEQLFDATRPDFTPIYADLKTREAHAAA 274 ********************************************999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.20 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory