Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate N515DRAFT_3479 N515DRAFT_3479 glutathione S-transferase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5292 (211 letters) >FitnessBrowser__Dyella79:N515DRAFT_3479 Length = 210 Score = 66.2 bits (160), Expect = 4e-16 Identities = 64/208 (30%), Positives = 89/208 (42%), Gaps = 22/208 (10%) Query: 1 MELYTYYRSTSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRT 60 + LY Y S + ++VR L L Y+ +PV++ GE RQP YL INP G VPA+ Sbjct: 2 LTLYDYLPSQNGWKVRQLLRHLDLPYRTVPVSIFE---GEGRQPGYLRINPTGTVPAIAL 58 Query: 61 DEGALLVQSPAIIEYLEERYPQVPLLSADLTVRAHERGVAALIGCDIHPLHNVSVLNKLR 120 ++G L +S AI+ YL E P +P D RA L + SV+ LR Sbjct: 59 EDGRTLAESNAILAYLAEGTPYLP---GDAYGRA-----KVLQWLNFEQERVESVIGSLR 110 Query: 121 QW---GHDETQVTEWIGHWISQGLAAVEQL---MGDDGYCFGAAPGLADVYLIPQLYAAE 174 W G + + GL A+ L +G + + G+AD+ L A+ Sbjct: 111 YWTLTGQLAKRGPALVELKREAGLRALSMLDAELGTRPFVASESYGIADIALFAYASRAD 170 Query: 175 RFNVSLQAYPR----IRRVAALAAGHPA 198 L Y I RV A GH A Sbjct: 171 EAGFDLAPYSHFQAWIERVRA-QPGHLA 197 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 210 Length adjustment: 21 Effective length of query: 190 Effective length of database: 189 Effective search space: 35910 Effective search space used: 35910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory