GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pad-dh in Dyella japonica UNC79MFTsu3.2

Align Phenylacetaldehyde dehydrogenase; PAD; EC 1.2.1.39 (characterized)
to candidate N515DRAFT_2488 N515DRAFT_2488 succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase

Query= SwissProt::O06837
         (502 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2488 N515DRAFT_2488
           succinate-semialdehyde dehydrogenase /
           glutarate-semialdehyde dehydrogenase
          Length = 463

 Score =  218 bits (555), Expect = 4e-61
 Identities = 144/460 (31%), Positives = 230/460 (50%), Gaps = 11/460 (2%)

Query: 42  NPATGDTLTDVPDGDVEDVNAAVESAAATLQSDAWRRMPPSARERILLRLADLLEAHGDE 101
           NP TG+T+   P     +V  A++ A A  +  AW+ +  +AR ++L + ADLL     +
Sbjct: 7   NPYTGETVKTFPSATDAEVTQALDQAQAMFE--AWKDVGVAARVKVLQKAADLLRESHTQ 64

Query: 102 LARLETLNNGKLLIYSKMMEVGASAQWLRYMAGWATKLTGSTLDLSLPLPPDVRSRASTQ 161
            A++ TL  GK++  ++  EV   AQ L Y A  A +L      LS   P   +S    +
Sbjct: 65  YAKVLTLEMGKVIGEAEG-EVELCAQILEYYADHAEQLLAPE-KLSSRHPSYTQSWV--E 120

Query: 162 RVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAEETPLTALRLAELAMEAGLPA 221
            VP G++ A+ PWNFP    V   AP LA GN ++LK A   P  A     L  EAGLP 
Sbjct: 121 HVPQGILLAVEPWNFPYYQIVRIAAPQLAAGNVLILKHASNVPQCAAAFERLFREAGLPQ 180

Query: 222 GAL-NVVTGRGETAGDALVRHPKVAKVAFTGSTEVGRIIGSACGRSLKAVSLELGGKSPV 280
           G   N+   R +    A++  P+V  VA TGS   G ++ +  G++LK  ++ELGG    
Sbjct: 181 GGFTNLYATRDQLK--AIIEDPRVQGVALTGSEGAGAVVAAQAGQALKKSTMELGGADAF 238

Query: 281 IVLADCDPQEAAEGAAAAIFFNHGQVCTAGSRLYVHESIYEDVIQRLAVIGESIVVGSGL 340
           +VLAD D  +A + A     +N GQVC +  R+ V + IY+  +++       +  G  +
Sbjct: 239 VVLADADLDKAVQWAVTGRHWNAGQVCCSSKRIIVVDEIYDAFLEKYKAGVARLRAGDPM 298

Query: 341 EQGVHMGPMVSKKHHENVLRHIRNGIEDGADLICGGTEAPCAQGFFVKPTIFANREKKDI 400
           E    + PM S+   +++ + +   +  GA +   G E P ++G F +P + ++    D 
Sbjct: 299 EPSTTLAPMSSRGAVDDLKKQLEQAVAHGAKVEVIGAEVP-SRGAFFRPVLLSH-VSDDN 356

Query: 401 RLLSQEVFGPVLVATPFSDIAEVVNEANRSVYGLGASIWTNDLSAALRINDELEAGTVWV 460
                E FGPV       D A+ +  AN S +GLG S++T D+   + +  ++  G V++
Sbjct: 357 PARYWEFFGPVSQVIRARDEADAIRIANDSPFGLGGSVFTTDIKHGIEVAKKISTGMVYI 416

Query: 461 NTHNMVDPNLPFGGFKDSGVGREHGAAAIEHYTTTRSLVI 500
           N    V  +LPFGG + SG GRE     I+ +   + + +
Sbjct: 417 NHPTGVAADLPFGGVRRSGYGRELTGLGIKEFVNHKLIAV 456


Lambda     K      H
   0.317    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 515
Number of extensions: 17
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 502
Length of database: 463
Length adjustment: 34
Effective length of query: 468
Effective length of database: 429
Effective search space:   200772
Effective search space used:   200772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory