GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimB in Dyella japonica UNC79MFTsu3.2

Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate N515DRAFT_3009 N515DRAFT_3009 acetyl-CoA C-acetyltransferase

Query= metacyc::MONOMER-20679
         (395 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 N515DRAFT_3009
           acetyl-CoA C-acetyltransferase
          Length = 427

 Score =  169 bits (428), Expect = 1e-46
 Identities = 125/405 (30%), Positives = 195/405 (48%), Gaps = 71/405 (17%)

Query: 39  VKRAGIDPKEVEDVVMGAAMQQGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIA 98
           V+R  +  +E+ +V MGA ++  +   N+AR+A+L +GL  TT G T  R C + L    
Sbjct: 42  VERFRLHGEELGEVAMGAVIKHSSEW-NLAREAVLSSGLAPTTPGITTARACGTSLDNAI 100

Query: 99  LAARSVLFDGVEIAVGGGGESISLVQ--------------------NDKMNTF------H 132
           + A  +    +E  + GG ++ S V                      DKM  F       
Sbjct: 101 IIANKIAAGQIEAGIAGGSDTTSDVPIVLGERFRKRLLAINRAKGWQDKMAAFTRGFSLK 160

Query: 133 AVDPALEAI-KGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRTAAAQQGGKFNDEI 191
            + P+   + +    M+M D  E +AK + I RE QD  +LES ++ AAA + G F D +
Sbjct: 161 ELKPSFPGVAEPRTGMSMGDHCERMAKEWHIGREAQDRLALESHQKLAAAYEAGFFEDLV 220

Query: 192 APISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKA----VRGEGFTITAGN 247
            P                     L +D   R +++ E L  LK     + G G T+TAGN
Sbjct: 221 VPFRG------------------LKRDGFLRADSSMEKLGTLKPAFDKISGHG-TLTAGN 261

Query: 248 ASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCE---PDEMGIGPVFAVPRLLKR 304
           ++ LSDGA+A ++ SD+ AA +GLK    F        +    + + + P  AVPR+L R
Sbjct: 262 STGLSDGAAAVLLGSDEWAARRGLKVQAYFLDAEVAAVDFVHGEGLLMAPTVAVPRMLAR 321

Query: 305 HGLSVDDIGLWELNEAFAVQVL----------YCRDKLG-------IDPEKLNVNGGAIS 347
           HGL++ D   +E++EAFA QVL          YCR++LG       IDP KLNV+G +++
Sbjct: 322 HGLTLQDFDFYEIHEAFAAQVLCTLRAWESETYCRNRLGLEQPLGSIDPAKLNVHGSSLA 381

Query: 348 VGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFE 392
            GHP+  +GAR+          + +   ++++C  GGMG   + E
Sbjct: 382 AGHPFAATGARIVATLAKMLEEKGSGRGLISICTAGGMGVTAILE 426


Lambda     K      H
   0.316    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 405
Number of extensions: 21
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 395
Length of database: 427
Length adjustment: 31
Effective length of query: 364
Effective length of database: 396
Effective search space:   144144
Effective search space used:   144144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory