GapMind for catabolism of small carbon sources

 

Aligments for a candidate for N515DRAFT_2924 in Dyella japonica UNC79MFTsu3.2

Align Basic amino acid/polyamine antiporter, APA family (characterized, see rationale)
to candidate N515DRAFT_0722 N515DRAFT_0722 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)

Query= uniprot:A0A1I1Y8J0
         (492 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0722 N515DRAFT_0722 amino
           acid/polyamine/organocation transporter, APC superfamily
           (TC 2.A.3)
          Length = 479

 Score =  532 bits (1371), Expect = e-156
 Identities = 262/489 (53%), Positives = 347/489 (70%), Gaps = 14/489 (2%)

Query: 1   MLKNLFATTQISPASADLPGGGAHGEATLKRALTARHLVLLGIGAIIGAGIFVITGQAAA 60
           ++++LFA   + P  A L       + +L+R L  + LV+LG+GA+IGAGIFVITGQAAA
Sbjct: 3   LIRSLFA---VKPVEASLTA-----DDSLRRTLGLKELVVLGVGAVIGAGIFVITGQAAA 54

Query: 61  EHAGPAIVLSFVFAGIACALAALCYAEFAAMLPVSGSAYSYSYATLGEYVAWFVGWSLVL 120
           EHAGPA+ LSFV AG+A ALAAL YAEFAAMLPVSGSAY Y+YAT GE +AWF+GW++V 
Sbjct: 55  EHAGPALTLSFVLAGLAAALAALSYAEFAAMLPVSGSAYVYAYATFGELLAWFIGWNVVA 114

Query: 121 EYLFTVATVAAGWSGYFNKLLALISGWIGHDVSLPQTLAAAPFTVVDGHIQATGMFINLP 180
           EYL  V++VA GWSGY   LL  +       + +P  LA AP +  DGH++ TG  +NLP
Sbjct: 115 EYLLAVSSVAVGWSGYGVGLLKSLG------IEVPAALANAPLSFKDGHLELTGALLNLP 168

Query: 181 AVAIIAAITGLCYVGITQSAFVNSIIVAIKVTVILLFIAFATKYINPDNWHPFIPASEGA 240
           A+ ++AA+T L Y G  QS    S++VA+KV V++LF+    +Y++P  WHP++PA++G 
Sbjct: 169 ALLVVAALTALLYRGTRQSTMFASVVVALKVIVVVLFVVCGLQYVDPSLWHPYVPANQGG 228

Query: 241 SKYGWAGVGRAAAIVFFSYIGFDAVSTAAGEAKNPQRDMPIGIIGSLILCTILYIIVAGI 300
             YGWAGV RAA  VF++YIGFDAV+TAA E +NPQR++P GI+ SL +CT+LYIIVA +
Sbjct: 229 DHYGWAGVFRAATSVFYAYIGFDAVATAAQETRNPQRNVPAGILISLAICTVLYIIVAAV 288

Query: 301 LTGIADFRLLGTPEPVSTALDNYPSLHWLQIIVVIGAVTGLSSVMLVMLMGQPRIFYSMA 360
           LTG+  +  L T EPV+TAL  +P L WL+++  +GAV GL+SV+LVM +G  RI YSMA
Sbjct: 289 LTGLVPYPQLATAEPVATALAAHPPLAWLKLLTQVGAVAGLTSVILVMHLGLSRILYSMA 348

Query: 361 RDGLIPAVFGRIHQKFRTPHVGTVVVGVLAAALGGLFNIGVLGEMVAMGTLLAFATVCIG 420
            DGL+P  FG +H++ RTPH  T++VG +   L  +F + +LG++++MGTLLAFATVCIG
Sbjct: 349 GDGLLPTFFGAVHERHRTPHRTTLLVGAVGGVLAAVFPLSLLGDLLSMGTLLAFATVCIG 408

Query: 421 VLVLRYTRPELPRAFRVPVPWIVCPLGALACMALFLQSFLEHWRWMLAWIAIGQAIYFLY 480
           VLVLR T P LPR FRVP    VC LG L C  L  Q  L +W  + AW  +G  IY  Y
Sbjct: 409 VLVLRRTHPNLPRGFRVPAAPAVCTLGVLVCAFLLAQMNLGNWILLAAWTTLGMLIYIAY 468

Query: 481 GYSHSKLRK 489
           GY HS +R+
Sbjct: 469 GYRHSLMRR 477


Lambda     K      H
   0.328    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 768
Number of extensions: 25
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 492
Length of database: 479
Length adjustment: 34
Effective length of query: 458
Effective length of database: 445
Effective search space:   203810
Effective search space used:   203810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory