GapMind for catabolism of small carbon sources


Aligments for a candidate for acn in Dyella japonica UNC79MFTsu3.2

Align Aconitate hydratase A; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC; EC (characterized)
to candidate N515DRAFT_0029 N515DRAFT_0029 aconitase /2-methylcitrate dehydratase (trans-methylaconitate-forming)

Query= SwissProt::Q937N8
         (869 letters)

>lcl|FitnessBrowser__Dyella79:N515DRAFT_0029 N515DRAFT_0029
           aconitase /2-methylcitrate dehydratase
          Length = 869

 Score = 1511 bits (3912), Expect = 0.0
 Identities = 756/873 (86%), Positives = 808/873 (92%), Gaps = 11/873 (1%)
















Lambda     K      H
   0.318    0.135    0.398 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2239
Number of extensions: 86
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 869
Length of database: 869
Length adjustment: 42
Effective length of query: 827
Effective length of database: 827
Effective search space:   683929
Effective search space used:   683929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

Align candidate N515DRAFT_0029 N515DRAFT_0029 (aconitase /2-methylcitrate dehydratase (trans-methylaconitate-forming))
to HMM TIGR02333 (acnD: 2-methylisocitrate dehydratase, Fe/S-dependent (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02333.hmm
# target sequence database:        /tmp/gapView.18366.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02333  [M=858]
Accession:   TIGR02333
Description: 2met_isocit_dHY: 2-methylisocitrate dehydratase, Fe/S-dependent
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
          0 1793.1   0.2          0 1792.9   0.2    1.0  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_0029  N515DRAFT_0029 aconitase /2-meth

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_0029  N515DRAFT_0029 aconitase /2-methylcitrate dehydratase (trans-methylaconi
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1792.9   0.2         0         0       1     858 []       2     864 ..       2     864 .. 0.99

  Alignments for each domain:
  == domain 1  score: 1792.9 bits;  conditional E-value: 0
                                    TIGR02333   1 ntkyrkalpgtdldyfdaraaveaikpgaydklpytsrvlaenlvrrvdpetleaslkqlierkre 66 
                                                  nt yr++l gt+ldyfdaraaveai+pgayd+lpytsrvlaenlvrr+dp+ l +slkq+ierkre
                                                  899*************************************************************** PP

                                    TIGR02333  67 ldfpwyparvvchdilgqtalvdlaglrdaiaekggdpaqvnpvvetqlivdhslaveyggfdpda 132
                                                  ****************************************************************** PP

                                    TIGR02333 133 feknraiedrrnedrfhfinwtkkafknvdvipagngimhqinlekmspvvqvk.....egvafpd 193
                                                  f++nraiedrrnedrfhfi+wt++af+nvdvip+gngimhqinlekmspv+qv+     +gva+pd
                                                  ****************************************************974444469***** PP

                                    TIGR02333 194 tlvgtdshtphvdalgviaigvggleaetvmlgraslmrlpdivgveltgkrqpgitatdivlalt 259
                                                  ****************************************************************** PP

                                    TIGR02333 260 eflrkekvvsayleffgegakaltlgdratisnmtpeygataamfaideqtidylkltgreeeqvk 325
                                                  eflr+ekvv+aylef gega +ltlgdratisnm+peygataamf+id+qt+dyl+ltgr +eqv+
                                                  ****************************************************************** PP

                                    TIGR02333 326 lvetyakaaglwadslkkavyervlkfdlssvvrnlagpsnpharlatsdlaakgiakeveeeaeg 391
                                                  lvetyakaaglwad+l  a+yer+l+fdlssvvrn+agpsnph+rl+t+dlaa+gia++++e++ g
                                                  ****************************************************************.* PP

                                    TIGR02333 392 lmpdgaviiaaitsctntsnprnvvaagllarnanklglkrkpwvksslapgskvvklyleeagll 457
                                                  +mpdgaviiaaitsctntsnprnv+aa+llarnan++gl rkpwvksslapgsk+v+lyl+ea+ll
                                                  ****************************************************************** PP

                                    TIGR02333 458 keleklgfgivafacttcngmsgaldpviqqeiidrdlyatavlsgnrnfdgrihpyakqaflasp 523
                                                  ****************************************************************** PP

                                    TIGR02333 524 plvvayaiagtirfdiekdvlgvdadgkeirlkdiwpsdeeidavvaaavkpeqfrkvyipmfdle 589
                                                  plvvayaiagtirfdie+dvlg+da+g+++ lkdiwpsdeeid++vaa+vkpeqfrkvy+pmf+  
                                                  ***************************************************************987 PP

                                    TIGR02333 590 .daqkkvsplydwrpmstyirrppywegalagertlkgmrplavlgdnittdhlspsnailldsaa 654
                                                    ++++++plydwr +styirrppywegalagertlkgmr lavlgdnittdhlspsnai++dsaa
                                                  6999************************************************************** PP

                                    TIGR02333 655 geylakmglpeedfnsyathrgdhltaqratfanpklfnemvkedgkvkqgslariepegkvtrmw 720
                                                  geyla+mglpeedfnsyathrgdhltaqratfanp l nem+ +dg+vk+gslar+epegkv+rmw
                                                  ****************************************************************** PP

                                    TIGR02333 721 eaietymnrkqpliiiagadygqgssrdwaakgvrlagveaivaegferihrtnlvgmgvlplefk 786
                                                  eaietym+rkqpli+iagadygqgssrdwaakgvrlagveai aegferihrtnl+gmgvlplef+
                                                  ****************************************************************** PP

                                    TIGR02333 787 pgtnrktlaldgtevydvvgeitpradltlvvtrkngeklevpvtcrldtaeevsvyeaggvlqrf 852
                                                  pgt+rktl++dgte++dv g++tpra+ltlv++r+nge++evpvtcrldtaeevs+yeaggvlqrf
                                                  ****************************************************************** PP

                                    TIGR02333 853 aqdfle 858
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0029 859 AQDFLE 864
                                                  ****97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (858 nodes)
Target sequences:                          1  (869 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.02s 00:00:00.08 Elapsed: 00:00:00.09
# Mc/sec: 8.25

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory