Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate N515DRAFT_0973 N515DRAFT_0973 methylmalonyl-CoA mutase
Query= BRENDA::O74009 (563 letters) >FitnessBrowser__Dyella79:N515DRAFT_0973 Length = 1155 Score = 226 bits (576), Expect = 4e-63 Identities = 139/371 (37%), Positives = 223/371 (60%), Gaps = 13/371 (3%) Query: 195 LRGTVQNDILKEYIARGTYIFPPQPSMRLTTDIIMYCAEN-VPKWNPISISGYHIREAGA 253 +RGTVQ DILKE A+ T IF + ++R+ DI Y ++ V + +SISGYHI EAGA Sbjct: 788 VRGTVQADILKEDQAQNTCIFSTEFALRMMGDIQQYFVDHKVRNFYSVSISGYHIAEAGA 847 Query: 254 NAVQEVAFTLADGIEYVKAVIERGMDVDKFAPRLSFFFAAHNNFLEEIAKF-RAARRLWA 312 N + ++AFTL++G V+ + RGM +D FAP LSFFF+ N E R ARR+WA Sbjct: 848 NPISQLAFTLSNGFTIVEYYLARGMHIDDFAPNLSFFFS--NGMDPEYTVIGRVARRIWA 905 Query: 313 YIMKEWFNAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVLGGTQSLHTNSY 372 M+E + A + RS ML++H QT+G +L AQ+ + N +R +QAL A+ SLHTN+Y Sbjct: 906 RAMRERYGA-SARSQMLKYHIQTSGRSLHAQEIQFNDIRTTLQALYALFDNCNSLHTNAY 964 Query: 373 DEALSLPTEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQ 432 DEA++ PTE+SVR A+ Q II E G+ +P G++ ++ LTD + E + E I Sbjct: 965 DEAITTPTEESVRRAVAIQLIINRELGLNFNENPWQGSFVVDALTDLVEEAVYREFEAIS 1024 Query: 433 KMGGMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDE-----PIEVEILKV 487 + GG++ A++ Y + +I E + Y+++ +G ++GVN F+ + E+E+++ Sbjct: 1025 ERGGVLGAMDTMYQRGKIQEESMYYEQKKHDGSLPLIGVNTFLPKDHGGEIATEIELIRS 1084 Query: 488 DPSIREKQIERLKKLRSERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVT 547 + +QI+ ++ R N E+L L+N A +E N+ ++EA ++ +L +++ Sbjct: 1085 TEEEKGQQIDNVQAYAKAR-NGLAPESLKILQNTA-RERRNVFEQLMEAVKY-NSLGQIS 1141 Query: 548 DVLREIWGEYR 558 L ++ GEYR Sbjct: 1142 HALYDVGGEYR 1152 Score = 79.3 bits (194), Expect = 8e-19 Identities = 56/144 (38%), Positives = 78/144 (54%), Gaps = 7/144 (4%) Query: 54 DLGEDWNYMEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYATAEESNKRYKYLLSQG- 112 D G+ ++ + PG YP+T GVY G T R +AG T E +N+R+ Y LSQG Sbjct: 580 DWGDLVRFLMRENLPGYYPYTGGVYPYRRTGEDPT-RMFAGEGTPERTNRRFHY-LSQGG 637 Query: 113 -QTGLSVAFDLPTQLGYD-SDHPLAEGEVGKVGVAIDSLWDMRILFDGIPLD--KVSTSM 168 T LS AFD T G D + P G++G GV + +L DM+ L+ G L S SM Sbjct: 638 AATRLSTAFDSVTLYGEDPAPRPDIYGKIGNSGVNVATLDDMKKLYSGFDLSAPSSSVSM 697 Query: 169 TINSTAANLLAMYILVAEEQGVSQ 192 TIN A +LAM++ A +Q + + Sbjct: 698 TINGPAPIILAMFMNTAIDQNIEK 721 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1311 Number of extensions: 49 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 563 Length of database: 1155 Length adjustment: 41 Effective length of query: 522 Effective length of database: 1114 Effective search space: 581508 Effective search space used: 581508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory