Align Methylisocitrate lyase (EC 4.1.3.30) (characterized)
to candidate N515DRAFT_0020 N515DRAFT_0020 methylisocitrate lyase
Query= reanno::Cup4G11:RR42_RS11260 (302 letters) >FitnessBrowser__Dyella79:N515DRAFT_0020 Length = 295 Score = 456 bits (1174), Expect = e-133 Identities = 225/288 (78%), Positives = 253/288 (87%) Query: 11 SAGARFRQALADEHPLQVVGTINANHALLAKRAGYRAIYLSGGGVAAGSLGLPDLGISNL 70 S GARFR ALA E PLQV+G INANHALLA+RAGYRAIYLSGGGVAAGSLGLPDLGI+ L Sbjct: 6 SPGARFRAALAQEQPLQVIGAINANHALLARRAGYRAIYLSGGGVAAGSLGLPDLGINTL 65 Query: 71 DDVLTDVRRITDVCDVPLLVDVDTGFGASAFNVARTTRSLIKFGAGAMHIEDQVGAKRCG 130 DDVLTDVRRITDVCD+PL+VD+DTGFG SAFN+ART +SLIKFGA A HIEDQVGAKRCG Sbjct: 66 DDVLTDVRRITDVCDLPLMVDIDTGFGPSAFNIARTVKSLIKFGAAACHIEDQVGAKRCG 125 Query: 131 HRPGKEIVSQGEMADRIKAAVDARTDENFVIMARTDALAVEGLDKAIERAVACVEAGADA 190 HRPGKEIVS GEMADR+KAA DA+TD +F ++ARTDA+ EG+D AIERA+ACVEAGAD Sbjct: 126 HRPGKEIVSSGEMADRVKAAADAKTDADFFLIARTDAIQTEGVDAAIERAIACVEAGADG 185 Query: 191 IFPEAMTDLAMYRKFVDAVKVPVLANITEFGATPLFTTEELGGAGVSMVLYPLSAFRAMN 250 IF EA+ DL YR+F DAVK PVLANITEFG TPLF+ +EL AGV +VLYPLSAFRAMN Sbjct: 186 IFAEAVYDLPTYRRFADAVKAPVLANITEFGKTPLFSVDELRSAGVGIVLYPLSAFRAMN 245 Query: 251 KAAENVYAAIRRDGTQQNVVDTMQTRAELYESIGYHAYEQKLDALFAQ 298 KAAENVY AIRRDG Q+NV+DTMQTR ELY+ IGYH +E++LD LFA+ Sbjct: 246 KAAENVYQAIRRDGHQRNVIDTMQTREELYDRIGYHDFERRLDELFAR 293 Lambda K H 0.320 0.134 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 295 Length adjustment: 27 Effective length of query: 275 Effective length of database: 268 Effective search space: 73700 Effective search space used: 73700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_0020 N515DRAFT_0020 (methylisocitrate lyase)
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.2807.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-131 421.8 0.4 6.8e-131 421.6 0.4 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 N515DRAFT_0020 methylisocitrate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 N515DRAFT_0020 methylisocitrate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.6 0.4 6.8e-131 6.8e-131 2 284 .. 8 292 .. 7 293 .. 0.99 Alignments for each domain: == domain 1 score: 421.6 bits; conditional E-value: 6.8e-131 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeear 66 g+++r++l++e++lq++Gaina++alla++aG++a+YlsG+++aa slglPDlg+ tl++v++++r lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 8 GARFRAALAQEQPLQVIGAINANHALLARRAGYRAIYLSGGGVAAgSLGLPDLGINTLDDVLTDVR 73 689****************************************999******************** PP TIGR02317 67 ritrvtklpllvDaDtGfGe.alnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemv 131 rit+v++lpl+vD+DtGfG a+n+artvk+l++ g+aa+hieDqv +k+CGh++gke+vs em+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 74 RITDVCDLPLMVDIDTGFGPsAFNIARTVKSLIKFGAAACHIEDQVGAKRCGHRPGKEIVSSGEMA 139 *******************769******************************************** PP TIGR02317 132 kkikaavkakkdedfvliaRtDaraveGldaaieRakaYveaGadaiftealeseeefrefakavk 197 +++kaa++ak+d df+liaRtDa +eG+daaieRa a veaGad if+ea+ ++ +r+fa+avk lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 140 DRVKAAADAKTDADFFLIARTDAIQTEGVDAAIERAIACVEAGADGIFAEAVYDLPTYRRFADAVK 205 ****************************************************************** PP TIGR02317 198 vpllanmtefGktplltadeleelgykiviyPvtalRaalkaaekvyeelkkkGtqkelldklqtR 263 +p+lan+tefGktpl+++del+++g+ iv+yP++a+Ra++kaae+vy+ ++++G q++++d++qtR lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 206 APVLANITEFGKTPLFSVDELRSAGVGIVLYPLSAFRAMNKAAENVYQAIRRDGHQRNVIDTMQTR 271 ****************************************************************** PP TIGR02317 264 kelYellgyedyekkdkelfk 284 +elY+ +gy+d+e++++elf+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0020 272 EELYDRIGYHDFERRLDELFA 292 *****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.11 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory