Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 151 bits (381), Expect = 3e-41 Identities = 88/244 (36%), Positives = 140/244 (57%), Gaps = 10/244 (4%) Query: 17 LVQLAGIRKCF--DGKEV--IPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSG 72 +++ + K + DGK++ + L I +GE ++G SG GK+T++RLI LE G Sbjct: 1 MIRFVDVHKSYRVDGKDIPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGG 60 Query: 73 RIMLDNEDITHVP-----AENRYVNTVFQSYALFPHMTVFENVAFGLRMQ-KTPAAEITP 126 I++D ++T + A+ R + +FQ + L TV +N+AF LR+ +T A +I Sbjct: 61 SILIDGTEMTALGDAALRAQRRRIGMIFQHFNLLSSQTVADNIAFPLRLAGETDAGKIKA 120 Query: 127 RVMEALRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQM 186 RV E LR V LE A + P QLSGGQ+QRV IARA+ N+P +LL DE+ SALD + + Sbjct: 121 RVDELLRRVGLEAHASKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDPQTTASV 180 Query: 187 QNELKALQRKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAG 246 L + R+L +T V +TH+ + + DR+ V+ GRI + G +++ P++ Sbjct: 181 LELLAEINRELKLTIVLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPRHPTTRR 240 Query: 247 FIGE 250 F+ E Sbjct: 241 FVNE 244 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 336 Length adjustment: 29 Effective length of query: 349 Effective length of database: 307 Effective search space: 107143 Effective search space used: 107143 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory