Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate N515DRAFT_1583 N515DRAFT_1583 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= metacyc::MONOMER-16231 (254 letters) >FitnessBrowser__Dyella79:N515DRAFT_1583 Length = 334 Score = 148 bits (373), Expect = 2e-40 Identities = 93/250 (37%), Positives = 133/250 (53%), Gaps = 12/250 (4%) Query: 4 LEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAVKG 63 L+G L+TG +GIGRA A+ A+ GADV I Y S A+ +E G R + ++G Sbjct: 89 LKGMATLITGGDSGIGRAVAVLFAREGADVGIVYLESSDDAEETRRHVEQEGGRCLLIQG 148 Query: 64 DVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPVDVVER----TFKVNLHGA 119 DV DP Q V + VE FG +DV+V+NA F D D+ E TF+ NL+G Sbjct: 149 DVTDPDFCQQAVEETVEEFGHLDVLVNNAA---FQEHADTLEDITEEHMDLTFRTNLYGY 205 Query: 120 YFMVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGKHG 179 + M +AA M G SI+ S + L G Y+ TK +H+ +S + L K G Sbjct: 206 FHMARAALPHMKA---GASIINTGSETGLFGNPKLLDYSATKGAIHAFTRSLSANLVKKG 262 Query: 180 IRCNSVLPGTILTEINKDDLADQEKREYMEARTPLGRLGAPEDLAGPIVFLAS-DMAAYV 238 IR N+V PG + T +N D + ++ + P+GR PE++A VFLA+ A+Y+ Sbjct: 263 IRVNAVAPGPVWTPLNPADQPAKSVAKF-GSSNPMGRPAQPEEVAPAYVFLAAPSCASYI 321 Query: 239 TGAALLVDGG 248 +GA L V GG Sbjct: 322 SGAILPVMGG 331 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 334 Length adjustment: 26 Effective length of query: 228 Effective length of database: 308 Effective search space: 70224 Effective search space used: 70224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory