Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate N515DRAFT_3232 N515DRAFT_3232 xylose ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >FitnessBrowser__Dyella79:N515DRAFT_3232 Length = 513 Score = 152 bits (385), Expect = 1e-41 Identities = 90/244 (36%), Positives = 140/244 (57%), Gaps = 9/244 (3%) Query: 10 RGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPD--EGEIRLEG 67 RG+ K +G V ALD D L GE L + G+NGAGKS+++K +SG +GEI +G Sbjct: 11 RGIAKSFGGVKALDGIDLRLRAGECLGLCGENGAGKSTLMKVLSGVYPHGSWDGEILWQG 70 Query: 68 KPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAAME 127 +P++ RS ++ +AGI ++Q L L P LS+A+N+FLG EI +PG +D AM Sbjct: 71 QPLRARSVRDSERAGIVIIHQELMLVPQLSVAENIFLGHEITRPG------GRMDYDAMY 124 Query: 128 KQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKES 187 +A A L ELGL + N+ GG +Q +A+A A +K++I+DEPT++L E+ Sbjct: 125 AKADALLQELGLHDV-NVALPAMHYGGGHQQLFEIAKALAKQAKLLILDEPTSSLTSSET 183 Query: 188 RRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSDAVAFM 247 +L ++ D++RRG+ + ISH + V V D + + R GR + + + + M Sbjct: 184 EVLLGIVEDLKRRGVACIYISHKLDEVERVCDTVCVIRDGRHIATQPMHELDVDTLITLM 243 Query: 248 TGAK 251 G K Sbjct: 244 VGRK 247 Score = 97.4 bits (241), Expect = 5e-25 Identities = 67/211 (31%), Positives = 107/211 (50%), Gaps = 10/211 (4%) Query: 22 LDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEG-EIRLEGKPIQFRSPMEARQ 80 +D F L GEIL + G GAG++ ++ AI GA T E+ LEG+P++ RSP +A + Sbjct: 282 VDDVSFQLRRGEILGIAGLVGAGRTELVSAIFGAYTGKSSVELFLEGRPLKIRSPADAIR 341 Query: 81 AGIETVYQNL---ALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAAMEKQARAKLSEL 137 AG+ V ++ + P L + DN+ L + G R + A+E Q + + Sbjct: 342 AGLGMVPEDRKRHGIVPLLGVGDNITLAT-LDHYAHAGHIDRQRELVAIEAQIAERRVKT 400 Query: 138 GLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDV 197 + + LSGG +Q +A+ KV+I+DEPT + V + LI ++ Sbjct: 401 ASPALP-----IARLSGGNQQKAVLAKMLLARPKVLILDEPTRGVDVGAKAEIYRLIFEL 455 Query: 198 RRRGLPIVLISHNMPHVFEVADRIHIHRLGR 228 +G+ IVL+S MP V +ADR+ + GR Sbjct: 456 AAQGVAIVLVSSEMPEVLGMADRVLVMGEGR 486 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 260 Length of database: 513 Length adjustment: 29 Effective length of query: 231 Effective length of database: 484 Effective search space: 111804 Effective search space used: 111804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory