Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate N515DRAFT_2415 N515DRAFT_2415 simple sugar transport system permease protein
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Dyella79:N515DRAFT_2415 Length = 337 Score = 162 bits (409), Expect = 1e-44 Identities = 112/335 (33%), Positives = 176/335 (52%), Gaps = 40/335 (11%) Query: 12 WYQRISRYQSIFILLGLIVLFS---FLSNRFLTLENFWIILRQTAVNLCIAVGMTFVILT 68 W++R ++ + L+ + + L + FLT + F +L A +AVGMTFVIL Sbjct: 18 WWRRRAQVPLLVTLVLFVAMAGAGGVLYHGFLTPQVFLNLLIDNAFLCIVAVGMTFVILA 77 Query: 69 GGIDLSVGSILGFSGAVTAKLL-KYGLILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGF 127 GGIDLSVG+++ FS + A+L+ ++G + PL A + + G G G Sbjct: 78 GGIDLSVGAVVAFSTVLLAELVQRHG-----------WPPLAAIALVLAVGTGFGAGMGV 126 Query: 128 IITRFNIPPFVATLGTMTAVRGFIMLLTKGHPITRLGDSFDF--------------IGSG 173 +I RF + PFV TL M RG L++ DS D +G G Sbjct: 127 LIQRFRLQPFVVTLAGMFLARGVATLISV--------DSIDIDQPWLASVANLRLPLGGG 178 Query: 174 WFLGIPMPVWIAAIATGVGIFILRKTQFGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAIS 233 L + V +A +A G + + FGR VYA+GG+E +A L G+ T + VYA+S Sbjct: 179 SMLSVGALVALAVVAAGA--LLAGASSFGRTVYAIGGSESSARLMGLPVDATVVRVYALS 236 Query: 234 GILSAVAGLIVTARLDSAQPNAGLMYELDAIAATVIGGASLSGGKGTLIGTVVGALIIGV 293 G +A+AG++ T + S L ELDAIAA VIGG L+GG G ++GT++G L++G+ Sbjct: 237 GFCAALAGVVYTLYMLSGYSQHALGLELDAIAAVVIGGTVLAGGSGYVLGTLLGVLVLGL 296 Query: 294 LNDGLVLVG-VSPFWQQVAKGFIIIAAVIAEKLGR 327 + +V G +S +W ++ G +++A + ++L R Sbjct: 297 IQTLIVFDGELSSWWTRIVIGALLLAFCLLQRLFR 331 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 337 Length adjustment: 28 Effective length of query: 303 Effective length of database: 309 Effective search space: 93627 Effective search space used: 93627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory