Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate N515DRAFT_3101 N515DRAFT_3101 ribokinase
Query= reanno::pseudo5_N2C3_1:AO356_00950 (304 letters) >FitnessBrowser__Dyella79:N515DRAFT_3101 Length = 297 Score = 225 bits (573), Expect = 1e-63 Identities = 135/301 (44%), Positives = 179/301 (59%), Gaps = 11/301 (3%) Query: 3 AKVVVIGSLNMDLVTRAPRLPRGGETLIGESFATIPGGKGANQAVAAARLGAQVSMVGCV 62 A+VVV+GS+NMDLVT APR GET++GE F T+PGGKGANQAVAAARLGA+V+++G + Sbjct: 2 ARVVVVGSINMDLVTLAPRFAGPGETVLGERFLTVPGGKGANQAVAAARLGAEVTLIGAL 61 Query: 63 GDDAYGEQLRGALLAEGIDCQAV-RVEQGSSGVALIVVDDNSQNAIVIVAGANGALTAEV 121 GDD +GEQLR L EGI V R++ SG A I V +N I++V AN +T Sbjct: 62 GDDTFGEQLREGLAREGIALDYVSRIDDCGSGTASITV-AGGENEIIVVPAANARVTPAQ 120 Query: 122 LDGVDDVLQSADVIICQLEVPDATVGHALKRGRALGKIVILNPAPASHALPADWYACIDY 181 ++ D + AD ++ Q+E+P +V L+ G LG VILNPAPA LP +W Y Sbjct: 121 VEAATDAIARADAVLVQMEIPLESVEATLRLGHRLGVPVILNPAPA-QKLPTEWLKLARY 179 Query: 182 LIPNESEAAVLSGLAVDSLETAEAAAAHLIAAGAGKVIVTLGAQGLMFANGASFEHFPAP 241 + PN+ E A+L L D+ + A L+ G V++T G +G + H Sbjct: 180 VTPNQHELAIL--LGADAQQDFRA----LMRQAPGPVVLTRGGEGAWYREDGEPTHQSGF 233 Query: 242 RVKAVDTTAAGDTFVGGFAAALACGKSEVDAIRFGQVAAALSVTRAGAQPSIPTLLEVQA 301 V VDTT AGDTF G A L G + A+R AAALSVTR GAQ +PT +E+ A Sbjct: 234 AVDVVDTTGAGDTFNGALAVFLHEGLPQ--AVRKACAAAALSVTRLGAQGGMPTRVELDA 291 Query: 302 F 302 + Sbjct: 292 W 292 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 297 Length adjustment: 27 Effective length of query: 277 Effective length of database: 270 Effective search space: 74790 Effective search space used: 74790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_3101 N515DRAFT_3101 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.12921.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-100 320.3 0.1 6.9e-100 320.2 0.1 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 N515DRAFT_3101 ribokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 N515DRAFT_3101 ribokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.2 0.1 6.9e-100 6.9e-100 1 297 [. 4 290 .. 4 291 .. 0.98 Alignments for each domain: == domain 1 score: 320.2 bits; conditional E-value: 6.9e-100 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgee 66 +vvvGSin+Dlv+ ++r++ pGetv +e f +++GGKGANQAvaaarlgaev++ig++G+D+fge+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 4 VVVVGSINMDLVTLAPRFAGPGETVLGERFLTVPGGKGANQAVAAARLGAEVTLIGALGDDTFGEQ 69 79**************************************************************** PP TIGR02152 67 llenlkkegidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlv 132 l+e l++egi +yv++++++ +G+A i+v+ geN+I+vv an+++tp++v+aa+++i+++d v lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 70 LREGLAREGIALDYVSRIDDCGSGTASITVAG-GENEIIVVPAANARVTPAQVEAATDAIARADAV 134 *******************************9.********************************* PP TIGR02152 133 llQlEipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedle 198 l+Q+Eiple+ve+ l++ ++ gv v+lnPAPa+k l++e+l+l+ +++pN++E++iL+g lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 135 LVQMEIPLESVEATLRLGHRLGVPVILNPAPAQK-LPTEWLKLARYVTPNQHELAILLGA------ 193 ********************************66.9***********************9...... PP TIGR02152 199 daekaaekllekgvkaviitlGskGallvskdekklipalkvkavDttaAGDtFigalavaLaegk 264 da++ ++l++++ v++t G +Ga + + +e ++ + + v++vDtt+AGDtF+galav L+eg lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 194 DAQQDFRALMRQAPGPVVLTRGGEGAWYREDGEPTHQSGFAVDVVDTTGAGDTFNGALAVFLHEG- 258 68899999999999*************************************************99. PP TIGR02152 265 sledavrfanaaaalsVtrkGaqssiPtkeeve 297 l +avr+a aaaalsVtr+Gaq ++Pt+ e++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 259 -LPQAVRKACAAAALSVTRLGAQGGMPTRVELD 290 .8899************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.02 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory