Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 137 bits (344), Expect = 5e-37 Identities = 79/225 (35%), Positives = 123/225 (54%), Gaps = 6/225 (2%) Query: 16 VEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRIDGEDATNIPPA-- 73 + + P L I DGE +G SG GKSTL+RLI LE + G+I IDG + T + A Sbjct: 18 IPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILIDGTEMTALGDAAL 77 Query: 74 ---KRGLAMVFQSYALYPHMSVRKNIAFPMKMAG-IPADEQKRRIDNAAAALNLTDYLDR 129 +R + M+FQ + L +V NIAFP+++AG A + K R+D + L + + Sbjct: 78 RAQRRRIGMIFQHFNLLSSQTVADNIAFPLRLAGETDAGKIKARVDELLRRVGLEAHASK 137 Query: 130 RPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELHKRLATTMIY 189 P QLSGGQ+QRV I RA+ P+ L DE S LD + ++E+++ L T++ Sbjct: 138 YPAQLSGGQKQRVGIARALANRPSILLCDEATSALDPQTTASVLELLAEINRELKLTIVL 197 Query: 190 VTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFI 234 +TH+ + D++ VL AG I + G+ +++ PR+ F+ Sbjct: 198 ITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPRHPTTRRFV 242 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 336 Length adjustment: 28 Effective length of query: 306 Effective length of database: 308 Effective search space: 94248 Effective search space used: 94248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory