Align sorbitol-6-phosphate dehydrogenase; EC 1.1.1.140 (characterized)
to candidate N515DRAFT_0557 N515DRAFT_0557 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= CharProtDB::CH_091827 (259 letters) >FitnessBrowser__Dyella79:N515DRAFT_0557 Length = 246 Score = 89.4 bits (220), Expect = 7e-23 Identities = 77/255 (30%), Positives = 121/255 (47%), Gaps = 20/255 (7%) Query: 3 QVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQS-DKAANVAQEINAEYGESMAYGFGAD 61 +VA+V GG + +GA + LA +G VA + S DKA + QEI A G++ AY AD Sbjct: 7 KVALVTGGSRGIGAAIVRRLARDGATVAFTYVSSPDKAQALVQEIEAAGGKARAYQ--AD 64 Query: 62 ATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAR 121 A ++ A V GR+D+LV +AGI D L DF+R++ VN+ F+ ++ Sbjct: 65 AADTAALQAAVDRVAAESGRLDILVNNAGIFLGGAFEDTTLEDFERTMAVNVRAVFVASQ 124 Query: 122 EFSRLMIRDGIQGRIIQINS-KSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVH 180 R M G GRI+ I S + +V S + YS +K T+ LA DL GITV+ Sbjct: 125 AAVRHM---GDGGRIVSIGSCLADRVPSAGMTLYSMSKSALSAFTRGLARDLGPRGITVN 181 Query: 181 SLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASP 240 + G+ T + + ++ +KR D ++ M+ + AS Sbjct: 182 VVQPGST-------------DTDMNPADGAHAEEQRGRMAIKRYGDASNIAGMVAWLASE 228 Query: 241 KASYCTGQSINVTGG 255 + + G + + GG Sbjct: 229 EGRFANGAAFTIDGG 243 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 246 Length adjustment: 24 Effective length of query: 235 Effective length of database: 222 Effective search space: 52170 Effective search space used: 52170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory