Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate N515DRAFT_2826 N515DRAFT_2826 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Dyella79:N515DRAFT_2826 Length = 247 Score = 119 bits (298), Expect = 6e-32 Identities = 88/273 (32%), Positives = 134/273 (49%), Gaps = 50/273 (18%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANV--------------QMIDIHGGDKHQSSGN 52 L+ +I VTG + GIG AI DEL AQGA V + + HGG Sbjct: 5 LQGEIALVTGASRGIGAAIADELAAQGATVIGTATSESGAAAIGERLAPHGGQGRV---- 60 Query: 53 YNFWPTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAF 112 +++ + VD I + G + LVNNAG+ +LL+ + + + Sbjct: 61 -----LNVTEPGAIEALVDAIGKDVGALSILVNNAGITRDQLLM---------RMRDEDW 106 Query: 113 EKMVNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTR 172 + +++ N V+ S+AV R M+K R G IV+++S GL G+ GQS YAA KA + +F++ Sbjct: 107 QAILDTNLTSVYRASKAVMRGMMKARKGRIVSIASVIGLTGNPGQSNYAAAKAGIIAFSK 166 Query: 173 SWSKELGKHGIRVVGVAPGILEKTGLRT--PEYEEALAWTRNITVEQLREGYSKNSIPLG 230 S ++E+G GI V VAPG ++ R E ++AL I LG Sbjct: 167 SLAREIGSRGITVNVVAPGFIDTDMTRALPEESKQALL----------------GQIALG 210 Query: 231 RSGRLTEVADFVCYLLSERASYMTGVTTNIAGG 263 R G ++A V +L S A+Y+TG T ++ GG Sbjct: 211 RLGEAQDIAKAVAFLASPAAAYITGETLHVNGG 243 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 247 Length adjustment: 24 Effective length of query: 243 Effective length of database: 223 Effective search space: 54189 Effective search space used: 54189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory