Align The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized)
to candidate N515DRAFT_1228 N515DRAFT_1228 MFS transporter, SP family, galactose:H+ symporter
Query= TCDB::Q9XIH7 (511 letters) >FitnessBrowser__Dyella79:N515DRAFT_1228 Length = 463 Score = 237 bits (605), Expect = 6e-67 Identities = 146/457 (31%), Positives = 237/457 (51%), Gaps = 30/457 (6%) Query: 31 ILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYSLVGSGAAGRTSDWL 90 +LA++ ++ G DIGV+SGAS FIK + +SD +E ++ + + VG+ AG S L Sbjct: 22 VLAALAGLMFGLDIGVISGASQFIKAEFAISDHTIEWIVSSMMFGAAVGALGAGWLSSHL 81 Query: 91 GRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTAEVAPASSR 150 GR+ +++L F G+LL G A + ++ R + G+ +G A AP+Y AEVAP R Sbjct: 82 GRKRSLILGAILFVIGSLLCGLAWSPETLIAARVILGLAIGIATFTAPLYLAEVAPEHIR 141 Query: 151 GFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGVGAVPSVFLAIGVLAMPESPR 210 G + S ++ I IGIL+ ++S+ + L H WR+MLGV A+P +GVL +P+SPR Sbjct: 142 GAMISTYQLMITIGILVAFLSD---TALSYHGAWRWMLGVIAIPGALFLLGVLGLPDSPR 198 Query: 211 WLVLQGRLGDAFKVLDKTSNTKEEAISRLDDIKRAVGIPDDMTDDVIVVPNKKSAGKGVW 270 WL+++GR +A VL + + DI+ + P D Sbjct: 199 WLMMRGRRDEAIDVLRRLRGDEVVVAREAADIEEQLKTPQRGWD---------------- 242 Query: 271 KDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSKAGLKSKNDQLLATVAVG 330 L P+ R + + QQ +G++ V+ Y+P IF + G + Q+ T VG Sbjct: 243 ---LFAENPNFRRSVFLGALLQIMQQFTGMNVVMYYAPRIFQEMGYDTA-AQMWFTALVG 298 Query: 331 VVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLT-VINRNPGQTLKWAIGLA 389 + L + ++DR+GR+ +L T M + L +G + IN GQT ++ Sbjct: 299 LTNVLATFIAIALIDRWGRKPILYTGFAVMAVGLGVVGALMNGGIN---GQTEQYT---C 352 Query: 390 VTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIGMTFLSLSKG 449 V ++ F+ F++ AGP+ W CSEI P++ R G + N + + ++G TFLSL Sbjct: 353 VAMLLFFIVGFAMSAGPLVWTLCSEIQPLKGRDFGIGVSTFTNWITNMVVGFTFLSLLNT 412 Query: 450 LTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEME 486 + F L+A + A V F +PET+G+ LE++E Sbjct: 413 IGNASTFWLYAALNAVFIVLTFWLVPETKGVTLEQIE 449 Lambda K H 0.324 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 695 Number of extensions: 55 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 511 Length of database: 463 Length adjustment: 34 Effective length of query: 477 Effective length of database: 429 Effective search space: 204633 Effective search space used: 204633 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory