Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate N515DRAFT_1821 N515DRAFT_1821 putative ABC transport system ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Dyella79:N515DRAFT_1821 Length = 238 Score = 117 bits (294), Expect = 2e-31 Identities = 73/215 (33%), Positives = 112/215 (52%), Gaps = 9/215 (4%) Query: 19 IHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGERVNDVPPSKRG-- 76 + ++D+KEGEFV GPSG GK+T L + LE TGG+ +DG V+++ + R Sbjct: 21 LRDFNIDVKEGEFVAVTGPSGSGKTTFLTIAGLLETFTGGEYHLDGVEVSNLNDNARSKI 80 Query: 77 ----IAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTPYLDRLPK 132 I +FQ++ L P + VYDN+ +R E +R+ A + + L P Sbjct: 81 RNEKIGFIFQAFNLIPDLNVYDNVEVPLRYRGMKALERKQRIMDALERVGLASRAKHYPA 140 Query: 133 ALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSDTTMIYVT 192 LSGGQ+QRVAI RA+ +P++ L DEP NLD + +E+ + R T++ VT Sbjct: 141 ELSGGQQQRVAIARALAGSPRLLLADEPTGNLDTQMARGV-MELLEEIHR-EGATIVMVT 198 Query: 193 HDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPA 227 HD E T A R V + G + + +++ A Sbjct: 199 HDP-ELATRAQRNVHVIDGQVVDLAEDPRFHQQQA 232 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 238 Length adjustment: 26 Effective length of query: 336 Effective length of database: 212 Effective search space: 71232 Effective search space used: 71232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory