Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate N515DRAFT_2414 N515DRAFT_2414 simple sugar transport system permease protein
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__Dyella79:N515DRAFT_2414 Length = 358 Score = 163 bits (413), Expect = 5e-45 Identities = 107/316 (33%), Positives = 168/316 (53%), Gaps = 17/316 (5%) Query: 36 LPVLVLLCIGFSVLTENFAGWQ--------NLSIIAQQASINMVLAAGMTFVILTGGIDL 87 L L+LL G + F Q NL IA +A+ +++ GMT VI G+D+ Sbjct: 34 LLTLILLLAGNGLFNPGFLALQWRDGHLYGNLIDIAHRAAPLALVSLGMTLVIALRGLDI 93 Query: 88 SVGSILSISAVVAMLV-------SLMPQLGMLSVPAALLCGLLFGIVNGALVAFMKLPPF 140 SVG++L+I+A VA L+P L++ AAL G L G+ NG LV + P Sbjct: 94 SVGAVLAIAATVAAWTIGHVSNDGLLPL--WLAIAAALAAGALCGLWNGWLVVGAGMQPI 151 Query: 141 IVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLR 200 + TL + A RG+A+ + + ++F+GNG VLG+P+ + + AV A+ LR Sbjct: 152 VATLILMVAGRGIAQSISGGQILTLYYAPYSFLGNGFVLGLPFSLFVVAAVFALLQLALR 211 Query: 201 RTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLG 260 +T LGL + A+G N +AA ++G++ + L Y G+ A L G++ S+ + +A+ G Sbjct: 212 KTALGLFVRAIGHNPQAAHVAGVRARAITLGAYVFCGIAAALAGLLVSSNVNSADANNAG 271 Query: 261 QSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVI 320 ELDAI AV LGG+ GG S+ G+L+GALII L+ + +GV +K +++ Sbjct: 272 LLLELDAILAVALGGSLLGGGRFSLAGSLLGALIIQALTTTIYAIGVPPQVNLAVKAVLV 331 Query: 321 IGAVALDSYRRKGSAR 336 + L S +G R Sbjct: 332 FAVMLLQSPLCRGQLR 347 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 358 Length adjustment: 29 Effective length of query: 308 Effective length of database: 329 Effective search space: 101332 Effective search space used: 101332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory