Align Fructose:H+ symporter, Frt1 (characterized)
to candidate N515DRAFT_1228 N515DRAFT_1228 MFS transporter, SP family, galactose:H+ symporter
Query= TCDB::Q8NJ22 (566 letters) >FitnessBrowser__Dyella79:N515DRAFT_1228 Length = 463 Score = 181 bits (458), Expect = 7e-50 Identities = 131/449 (29%), Positives = 220/449 (48%), Gaps = 19/449 (4%) Query: 92 VIMLGFFASFAGILSGVDQSTISGASYGMKASLKLTSDEDSLISSLMPLGAVGGSILLTP 151 VI A+ AG++ G+D ISGAS +KA ++ I S M GA G++ Sbjct: 17 VIYTCVLAALAGLMFGLDIGVISGASQFIKAEFAISDHTIEWIVSSMMFGAAVGALGAGW 76 Query: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211 LS + GRK +L++ I + IG +LC A T+ A R ++G+ +GI +Y+AE Sbjct: 77 LSSHLGRKRSLILGAILFVIGSLLCGLAWSPETLIAARVILGLAIGIATFTAPLYLAEVA 136 Query: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGWRYMLGSSLVFSTILFVGLFFLPE 271 P +RG+++S YQ I +G LV ++ G WR+MLG + + +G+ LP+ Sbjct: 137 PEHIRGAMISTYQLMITIGILVAFLSDTA-LSYHGAWRWMLGVIAIPGALFLLGVLGLPD 195 Query: 272 SPRWLIHKGYDVEAYKVWRRLRDTSDLGNKREFLEMKHAAEQDRQLKEQESRFKSMFDLI 331 SPRWL+ +G EA V RRLR E + + AA+ + QLK + + + Sbjct: 196 SPRWLMMRGRRDEAIDVLRRLRGD-------EVVVAREAADIEEQLKTPQRGWDLFAE-- 246 Query: 332 LIPRNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVAMSMVGGAALLIGT 391 P RR++ ++ + Q TG+N +MYY + ++G+ + + + G ++ T Sbjct: 247 -NPNFRRSVFLGALLQIMQQFTGMNVVMYYAPRIFQEMGYDTAAQMWFTALVGLTNVLAT 305 Query: 392 IPAILYMDKFGRRPWSMTIIGFSVGLVLVG-VGYQIDLNTNLAAAEGVYLTGQILYNIFF 450 AI +D++GR+P T GF+V V +G VG ++ N + + + + + F Sbjct: 306 FIAIALIDRWGRKPILYT--GFAVMAVGLGVVGALMNGGINGQTEQYTCVAMLLFFIVGF 363 Query: 451 GTYA-TLTWVVPSESFSLATRSIGMTICSAFLYLWAFTVTYNFNKMKDAFTYTGLTLGFY 509 A L W + SE L R G+ + + ++ V + F + + T Y Sbjct: 364 AMSAGPLVWTLCSEIQPLKGRDFGIGVSTFTNWITNMVVGFTFLSLLNTIG-NASTFWLY 422 Query: 510 GGI-AIVIGIPYQLLFMPETKDKTLEEID 537 + A+ I + + L +PETK TLE+I+ Sbjct: 423 AALNAVFIVLTFWL--VPETKGVTLEQIE 449 Lambda K H 0.323 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 566 Length of database: 463 Length adjustment: 35 Effective length of query: 531 Effective length of database: 428 Effective search space: 227268 Effective search space used: 227268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory