GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruP in Dyella japonica UNC79MFTsu3.2

Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate N515DRAFT_0592 N515DRAFT_0592 glucose/galactose transporter

Query= uniprot:A0A1I2JXG1
         (442 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0592 N515DRAFT_0592
           glucose/galactose transporter
          Length = 430

 Score =  221 bits (563), Expect = 3e-62
 Identities = 144/416 (34%), Positives = 217/416 (52%), Gaps = 13/416 (3%)

Query: 29  MGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAGLLVAR 88
           M ++  +FF++GF+T LN  LI  +K  F L+   A LV   F+ +YF ++LP+  ++ R
Sbjct: 21  MLIIGLLFFIFGFVTWLNGPLITFVKLAFSLDDVNAFLVPMVFYCSYFFLALPSSAVLKR 80

Query: 89  LGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYVALLGP 148
            G KKG+  GL V  +GA  F    +M  Y   L  LFV+  G+ +LQ A+N Y+++LGP
Sbjct: 81  TGMKKGMALGLFVMAIGAVLFGQFVSMRVYGGALAGLFVIGAGLALLQTASNPYISILGP 140

Query: 149 EKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSAEQI-AKLSPAEQVAYRVQEAQT 207
             SA+ R+      N +   LAP   G L+LS      +Q+ A  +P  + A     A  
Sbjct: 141 IDSAAQRIAFMGICNKVAGALAPFVFGWLVLSGIDTFDQQVKAAPTPEAREALLNTFAAK 200

Query: 208 VQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQASVK-QHSLVSPLRHPHVLFGVLAIFF 266
           V  PYL +A +L LLAV+V    LP +      +  +  H+  + L  PH+  GVL +F 
Sbjct: 201 VHMPYLAMAGLLVLLAVWVLRSPLPEIKPSGANSEAEIGHAKGNLLSFPHLWLGVLCLFL 260

Query: 267 YVGGEVAIGSFLVNY---LSMPDIGNMSEQAAANWVAYYWLGAMIGRFIGSALLAK-LSP 322
           YVG EV  G  +  Y   L +P        A  ++ ++     ++G   G  L+ K +S 
Sbjct: 261 YVGVEVMAGDAIGTYGQGLGLP------LDATKHFTSFTLFAMLLGYLAGLVLIPKIISQ 314

Query: 323 RKLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERMGPMTGEAS 382
           +  LA+ A + +A  +    T G  ++  V ++G  N++M+P IF L I+ +G  T   S
Sbjct: 315 QSYLAVSAVLGVAFTVGAWATTGYTSVGFVAALGFANAMMWPAIFPLAIKGLGRWTEAGS 374

Query: 383 SLLIMAIVGGAIVPFVQGLFADHIGVQHAFFLPLL-CYAYIVFYGLYGSRIKSDTP 437
           +LLIMAIVGGA+VP        H   Q  F L ++ CY YI+FYGL G R+    P
Sbjct: 375 ALLIMAIVGGALVPQAFVHLKQHYDFQLVFMLLMVPCYLYILFYGLRGHRVGQHAP 430


Lambda     K      H
   0.327    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 514
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 442
Length of database: 430
Length adjustment: 32
Effective length of query: 410
Effective length of database: 398
Effective search space:   163180
Effective search space used:   163180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory