Align UTP--glucose-1-phosphate uridylyltransferase AglF; Archaeal glycosylation protein F; EC 2.7.7.9 (characterized)
to candidate N515DRAFT_4302 N515DRAFT_4302 glucose-1-phosphate thymidylyltransferase
Query= SwissProt::D4GYH1 (243 letters) >FitnessBrowser__Dyella79:N515DRAFT_4302 Length = 295 Score = 84.7 bits (208), Expect = 2e-21 Identities = 61/200 (30%), Positives = 98/200 (49%), Gaps = 6/200 (3%) Query: 2 QAVVLAAGKGTRLRPLTEDKPKGMVEVDGKPILTHCFDQLVDLGAEKLVVVVGYKKEIII 61 + ++LA G GTRL P+T+ K ++ V KP++ + L+ G +++V+ ++ + Sbjct: 5 KGIILAGGSGTRLYPITQAVSKQLLPVYDKPMIYYPLATLMLAGVREILVINTPHEQPLF 64 Query: 62 QHY--DDEYRGVPITYAHQREQKGLAHALLTVEDHIDED-FMLMLGDNIF-NANLGDVVK 117 + D G+ I YA Q GLA A L + I D L+LGDNIF L + +K Sbjct: 65 ERLLGDGSQWGIDIRYAVQPSPDGLAQAFLIGREFIGNDPSCLVLGDNIFYGVGLTERLK 124 Query: 118 RQREDRADAAFLVEEVDWDEASRYGVCVTNDYGEITEVIEKPEEPPSNLVMTGFYTFTPA 177 R A V + RYGV + G + + EKP +P S+ +TG Y + Sbjct: 125 RASSREHGATVFGYWVR--DPERYGVAEFDSSGRVIGLEEKPAQPKSSYAVTGLYFYDNR 182 Query: 178 IFHACHLVQPSNRGEYEISE 197 + ++PS RGE EI++ Sbjct: 183 VCDYAASLKPSARGELEITD 202 Lambda K H 0.318 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 295 Length adjustment: 25 Effective length of query: 218 Effective length of database: 270 Effective search space: 58860 Effective search space used: 58860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory