Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 197 bits (501), Expect = 4e-55 Identities = 116/301 (38%), Positives = 174/301 (57%), Gaps = 21/301 (6%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M ++ + + KV+ G V + + I +GE ++GPSG GKTT +R+IAGL+ S G Sbjct: 1 MAKVRLDKLRKVYPNGHV-GVAEASFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGG 59 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 L +R+V + P+DR I MVFQ +ALYP++T EN+ F L K EI +R Sbjct: 60 TLSIGERVVND-----IAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERR 114 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 V E A++L++ L+ P LSGGQ+QRVAL RALV+DP + LLDEP SNLDA++R S R Sbjct: 115 VAEAARMLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMR 174 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASL 240 + + RL T++ V+HD + + R+ VL G + Q+ P +LYD P ++ VA Sbjct: 175 VEIARIHQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGF 234 Query: 241 IGE--INELEGKVTNEG----------VVIGSLRFPVSVSSDR---AIIGIRPEDVKLSK 285 +G +N L G + +G +V+G L ++ + R ++G+RPED+ L Sbjct: 235 LGSPAMNLLRGILYRDGGWKLAMPQGELVLGELPQGAALEAWRDRDIVVGLRPEDLLLCA 294 Query: 286 D 286 D Sbjct: 295 D 295 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 364 Length adjustment: 29 Effective length of query: 324 Effective length of database: 335 Effective search space: 108540 Effective search space used: 108540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory