GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glk in Dyella japonica UNC79MFTsu3.2

Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate N515DRAFT_0593 N515DRAFT_0593 glucokinase

Query= curated2:Q2W5F9
         (321 letters)



>FitnessBrowser__Dyella79:N515DRAFT_0593
          Length = 353

 Score =  208 bits (530), Expect = 1e-58
 Identities = 123/323 (38%), Positives = 175/323 (54%), Gaps = 8/323 (2%)

Query: 6   LVADIGGTHARFALMGPDGEAVNPVVL------RCADYDGPAPAIKAYLAEHAGGVAPKG 59
           L AD+GGTHAR  L+    +   PV +       CA++      +K ++++  G V    
Sbjct: 21  LAADVGGTHARIGLVSQRPDGARPVTVLQYHRYACAEWPSLTAVLKDFVSQLGGAVQVDQ 80

Query: 60  GAFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMS 119
            A A A  + GD I   N PW  SI + R ++G++RL VVNDF AVA + + L       
Sbjct: 81  CAVASAGYVLGDAIVNDNLPWPVSIRDIRDSLGIERLAVVNDFEAVAYATQFLVHADTTP 140

Query: 120 VGGGMPEAGL-PIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDR 178
           V       G+ P+ V+GPGTGLG + L+P      T LATE G + ++   ERE  IL  
Sbjct: 141 VIEAQTPGGVGPVLVMGPGTGLGSAVLLPGKPHA-TVLATEAGQIALSPGNEREIEILRV 199

Query: 179 LRTQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEV 238
           L  +  +VS E  LSG GL+NLY+A+  L G   V + P  IT+  LD S   + EA+EV
Sbjct: 200 LAGERPYVSFEHALSGPGLLNLYRALCVLRGQSPVLAKPSEITRAALDASDAAAVEALEV 259

Query: 239 FFAMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPT 298
           F  ++G+  G+L L  GA+GGVF+AGGILP++ +    SSFR RF   G  + +L  +P 
Sbjct: 260 FCGLLGSFVGDLTLLYGARGGVFLAGGILPQIRDVLLTSSFRERFFNKGVMRAFLQQVPV 319

Query: 299 WLITHPLPAFVGLAGLVTDPKNA 321
            L+ H     +G AG+  +   A
Sbjct: 320 RLMEHGQLGVIGAAGMYLEGHTA 342


Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 379
Number of extensions: 22
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 321
Length of database: 353
Length adjustment: 28
Effective length of query: 293
Effective length of database: 325
Effective search space:    95225
Effective search space used:    95225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate N515DRAFT_0593 N515DRAFT_0593 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.24924.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.24924.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.