Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate N515DRAFT_2392 N515DRAFT_2392 putative ABC transport system ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >FitnessBrowser__Dyella79:N515DRAFT_2392 Length = 254 Score = 124 bits (311), Expect = 3e-33 Identities = 75/225 (33%), Positives = 120/225 (53%), Gaps = 8/225 (3%) Query: 2 ASSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPT 61 A+ + + + K F + L V + +A GE++ + GPSGCGK+TLL+I+ LD T Sbjct: 5 ANVITLRDLRKVFQTDEVETHALSDVHLSIARGEYVSISGPSGCGKTTLLSILGLLDTAT 64 Query: 62 EGEIRIGGKNVVGMPP------RDRDIAMVFQSYALYPTLSVADNIGFALEMRK-MPKPE 114 G + G +V + R+ +I +FQ++ L LSV +N+ L R + E Sbjct: 65 SGSFVLNGHDVATLNAAQRARIRNAEIGFIFQAFNLIGDLSVQENVELPLTYRSSIGAAE 124 Query: 115 RQKRIDEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLR 174 R+ R+ E + ++H + P+QLSGGQ+QRVA+ RAL +P + L DEP NLD++ Sbjct: 125 RRARVQEALERVGMAHRMRHYPAQLSGGQQQRVAVARALVGRPAILLADEPTGNLDSRNG 184 Query: 175 VEMRAEIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQ 219 + + + LH+ G T VTHD A ++ + G VV + Sbjct: 185 EAVMSLLDELHK-GGATICMVTHDARYAELAQRKVRLFDGRVVDE 228 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 254 Length adjustment: 27 Effective length of query: 328 Effective length of database: 227 Effective search space: 74456 Effective search space used: 74456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory