Align ABC transporter (characterized, see rationale)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 135 bits (339), Expect = 2e-36 Identities = 85/242 (35%), Positives = 130/242 (53%), Gaps = 10/242 (4%) Query: 19 LRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDL-----EPR 73 L+ SL+IA GE +G SG GKSTL+RLI L+ GG +LIDG + L + Sbjct: 21 LQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILIDGTEMTALGDAALRAQ 80 Query: 74 ERGVGMVFQSYALYPHMSVYDNISFGLKLA-KTDKTSLRERVLKTAQILQLDKLLQRKPK 132 R +GM+FQ + L +V DNI+F L+LA +TD ++ RV + + + L+ + P Sbjct: 81 RRRIGMIFQHFNLLSSQTVADNIAFPLRLAGETDAGKIKARVDELLRRVGLEAHASKYPA 140 Query: 133 ELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIYVTH 192 +LSGGQ+QRV + RA+A P ILL DE S LD + +A ++ L T++ +TH Sbjct: 141 QLSGGQKQRVGIARALANRPSILLCDEATSALDPQTTASVLELLAEINRELKLTIVLITH 200 Query: 193 DQVEAMTLADKIVVLNGGRVEQVGSPRELYERP----ASRFVAGFLGSPRMNFLSARLQT 248 + + D++ VL+ GR+ + G+ +++ P RFV L L+ Sbjct: 201 EMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPRHPTTRRFVNEALPEEAAGELAPYTHV 260 Query: 249 PG 250 PG Sbjct: 261 PG 262 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 336 Length adjustment: 29 Effective length of query: 352 Effective length of database: 307 Effective search space: 108064 Effective search space used: 108064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory