Align ABC transporter (characterized, see rationale)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 131 bits (330), Expect = 2e-35 Identities = 76/205 (37%), Positives = 110/205 (53%), Gaps = 6/205 (2%) Query: 16 MRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEP--- 72 + +L ++L IA G+F+ +GPSG GK+TLL LI GLDS GG + + G+R++ L Sbjct: 23 VEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGSIGVGGQRIDQLGAGAL 82 Query: 73 ---RERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDKLLQR 129 R VG VFQ Y L P ++ N+ L L K R+ Q++ LD+ Sbjct: 83 AKWRAANVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQRRKNAAIALQLVGLDERSSH 142 Query: 130 KPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIY 189 KP ELSGGQ+QRVA+ RA+ +P +L+ DEP +LD + + L+ G T++ Sbjct: 143 KPSELSGGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSAEDVLGLLRTLNREHGKTIVM 202 Query: 190 VTHDQVEAMTLADKIVVLNGGRVEQ 214 VTHD A + + G VEQ Sbjct: 203 VTHDPKAAEYANHTLHLDKGTLVEQ 227 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 230 Length adjustment: 26 Effective length of query: 355 Effective length of database: 204 Effective search space: 72420 Effective search space used: 72420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory