GapMind for catabolism of small carbon sources

 

Aligments for a candidate for D-LDH in Dyella japonica UNC79MFTsu3.2

Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate N515DRAFT_3582 N515DRAFT_3582 FAD/FMN-containing dehydrogenase

Query= SwissProt::P46681
         (530 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3582 N515DRAFT_3582
           FAD/FMN-containing dehydrogenase
          Length = 467

 Score =  281 bits (720), Expect = 3e-80
 Identities = 162/450 (36%), Positives = 248/450 (55%), Gaps = 22/450 (4%)

Query: 86  DLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIF 145
           DL  Y  DW R++      +  P +VE+   +L + N+  +AVVP GG TGL GG+V   
Sbjct: 31  DLEHYGRDWTRRWTPAPLAIALPATVEEAQAVLRWANEHGVAVVPSGGRTGLSGGAVAAQ 90

Query: 146 DELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGV 205
            EL+LSL  +N++  FDP+   L   AG+ L+  ++       ++P+D  A+GSC +GG 
Sbjct: 91  GELVLSLERMNRVLGFDPIDRTLTVQAGIALQAVHDAARSHGLIYPVDFAARGSCSIGGN 150

Query: 206 VATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIG 265
           +ATNAGG+R++RYG+    + GL+V+  NG+++     + K+++GYDL+ L IGSEGT+G
Sbjct: 151 IATNAGGIRVIRYGNTREWIAGLKVIAGNGELLELNRGLIKNSSGYDLRHLTIGSEGTLG 210

Query: 266 IITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMD--AKSQVLA 323
           I+   ++     P    V  L++     + +VF   R  L   L AFEF    A   VLA
Sbjct: 211 IVVEATLRLAEPPPPSQVMLLALPDMAALMQVFALFRARLK--LQAFEFFTDIALRHVLA 268

Query: 324 KSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETEL 383
                 A   L+ EHPFY++ E   +++   D+ L  F E+ + EG + DG +AQ E + 
Sbjct: 269 HG----AQRALDGEHPFYVVTEFDAADEAAQDAALAAF-EHGVNEGWIADGAIAQSEAQA 323

Query: 384 QNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAI 443
             LW+ RE I E S A    YK D+SL +  L + ++   A L +A        P    +
Sbjct: 324 AALWRLREGITE-SLAPHKPYKNDISLRIGALPAFLDEIQALLGDA-------YPHFEVV 375

Query: 444 GYGHVGDGNLHLNVAVREYNKNIE-----KTLEPFVYEFVSSKHGSVSAEHGLGFQKKNY 498
            +GH+GDGNLH+NV   E   + E     + +   +   +    GS+SAEHG+G  KK Y
Sbjct: 376 WFGHIGDGNLHINVLKPEGLADAEFIAQCEQVTKLLAAALQRHGGSISAEHGIGLVKKPY 435

Query: 499 IGYSKSPEEVKMMKDLKVHYDPNGILNPYK 528
           +  ++S  E+ +M+ +K  +DPNGILNP K
Sbjct: 436 LESTRSAAEIALMRGVKQVFDPNGILNPGK 465


Lambda     K      H
   0.316    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 523
Number of extensions: 22
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 530
Length of database: 467
Length adjustment: 34
Effective length of query: 496
Effective length of database: 433
Effective search space:   214768
Effective search space used:   214768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory