GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gcvH in Dyella japonica UNC79MFTsu3.2

Align Glycine cleavage system H protein (characterized)
to candidate N515DRAFT_4332 N515DRAFT_4332 glycine cleavage system H protein

Query= SwissProt::P0A6T9
         (129 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_4332 N515DRAFT_4332 glycine
           cleavage system H protein
          Length = 131

 Score =  157 bits (396), Expect = 7e-44
 Identities = 75/129 (58%), Positives = 94/129 (72%)

Query: 1   MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAV 60
           MS +P +LK+ K HEW R E +G   VGI++HAQ  LGD+V+V+LPE+GA+V  G   A 
Sbjct: 1   MSEIPGDLKFLKSHEWARAEDNGNVRVGISDHAQGQLGDVVYVELPEIGASVQVGHGVAT 60

Query: 61  AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDAT 120
            ESVKAASDIY PVSGEIV VN+AL+DSPE +N + Y  GW+F +K SD +EL  LLDA 
Sbjct: 61  VESVKAASDIYTPVSGEIVEVNEALADSPETINEDAYGEGWLFVVKPSDRAELGELLDAD 120

Query: 121 AYEALLEDE 129
           AY   LE+E
Sbjct: 121 AYAEQLENE 129


Lambda     K      H
   0.308    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 86
Number of extensions: 2
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 129
Length of database: 131
Length adjustment: 14
Effective length of query: 115
Effective length of database: 117
Effective search space:    13455
Effective search space used:    13455
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory