Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate N515DRAFT_4331 N515DRAFT_4331 aminomethyltransferase
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__Dyella79:N515DRAFT_4331 Length = 366 Score = 402 bits (1033), Expect = e-117 Identities = 214/367 (58%), Positives = 260/367 (70%), Gaps = 12/367 (3%) Query: 1 MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS 60 M ++T L H GARMVDF GW MP++YGSQI+EHHAVR DAGMFDVSHMT+VDL G Sbjct: 1 MTEKTVLNATHRALGARMVDFGGWDMPINYGSQIEEHHAVRQDAGMFDVSHMTVVDLHGE 60 Query: 61 RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK 120 RTREFLR+LLAN+V KL GKALYS ML+ GGVIDDLIVY+F + FRLVVN+ATR K Sbjct: 61 RTREFLRHLLANNVDKLKAQGKALYSCMLDEQGGVIDDLIVYFFDDRHFRLVVNAATRAK 120 Query: 121 DLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFF----- 175 DL+WI Q A+ FG+E+ R D SMIAVQGPNA+ K L ++ R+ + + F Sbjct: 121 DLAWIEQQAKAFGVEVKERPDFSMIAVQGPNARDKVIGLLHEVDRERIRKLGKFVAAAAQ 180 Query: 176 GVQAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNL 235 G LFIA TGYTGE G+EI +P E A W AL+ AGVKP GLGARDTLRLEAGMNL Sbjct: 181 GPHGMPLFIARTGYTGEDGFEIIVPEEHAVALWEALLAAGVKPAGLGARDTLRLEAGMNL 240 Query: 236 YGQEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEK-LVGLVMTEKGVLRN 294 YGQ+MDET+SP AN+GWTI+ + RDFIGR+ LE Q+ G ++ +VGLV+ EKGVLR+ Sbjct: 241 YGQDMDETVSPWEANLGWTISLDEG-RDFIGRKVLEAQKAAGVKRVMVGLVLDEKGVLRH 299 Query: 295 ELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKP 354 V + EG I SG+F+PTL ++A AR+P G V IR RE+PV+V K Sbjct: 300 GQKVLTANG-----EGEILSGSFAPTLNKAVAFARIPAGEPGEVRVDIRGREVPVRVVKY 354 Query: 355 VFVRNGK 361 FVR+GK Sbjct: 355 PFVRDGK 361 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 366 Length adjustment: 30 Effective length of query: 334 Effective length of database: 336 Effective search space: 112224 Effective search space used: 112224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_4331 N515DRAFT_4331 (aminomethyltransferase)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.7626.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-133 431.3 0.0 1.5e-133 431.1 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 N515DRAFT_4331 aminomethyltransf Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 N515DRAFT_4331 aminomethyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.1 0.0 1.5e-133 1.5e-133 2 361 .. 3 358 .. 2 359 .. 0.94 Alignments for each domain: == domain 1 score: 431.1 bits; conditional E-value: 1.5e-133 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqr 67 ++t L h lg+++vdf+Gw +P++y+s+ieeh+avr++aG+fDvshm+ v+l G+++++fL++ lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 3 EKTVLNATHRALGARMVDFGGWDMPINYGSQIEEHHAVRQDAGMFDVSHMTVVDLHGERTREFLRH 68 689999************************************************************ PP TIGR00528 68 llanDvdaLtk.GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeev 132 llan+vd+L Gka+ys +l qGGv+DDlivy + + +f+lvvnaat+ kDl+w++++++ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 69 LLANNVDKLKAqGKALYSCMLDEQGGVIDDLIVYFFDDR-HFRLVVNAATRAKDLAWIEQQAKAFG 133 *********988**********************98777.************************** PP TIGR00528 133 tldtlskeisllalqGPkakt....iledlldkaveglkefffvqeaelalkkaliartGytGedG 194 + + + + s++a+qGP+a++ +l+++ ++ + +l +f+ ++ + +iartGytGedG lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 134 VEVKERPDFSMIAVQGPNARDkvigLLHEVDRERIRKLGKFVAAAAQGPHGMPLFIARTGYTGEDG 199 *****************7765433367777777777777777776666666667************ PP TIGR00528 195 feiavanekavelwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker 260 fei+v++e+av lw++l++a gvkP GLgarDtLrleagm+LyGq++de+++P ea+lgw+++++ lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 200 FEIIVPEEHAVALWEALLAA-GVKPAGLGARDTLRLEAGMNLYGQDMDETVSPWEANLGWTISLD- 263 ********************.********************************************. PP TIGR00528 261 kksdfiGravleeqkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknia 326 + +dfiGr+vle qk+ g+++ +vGl++ ekg++r++ kvl++ng +G + sG+++PtL+k++a lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 264 EGRDFIGRKVLEAQKAAGVKRVMVGLVLDEKGVLRHGQKVLTANG---EGEILSGSFAPTLNKAVA 326 9*****************************************999...9***************** PP TIGR00528 327 layvdkelekiGtklevevrnklvkikvvkklfvr 361 a+++ ++ ++ v++r+++v+++vvk +fvr lcl|FitnessBrowser__Dyella79:N515DRAFT_4331 327 FARIP---AGEPGEVRVDIRGREVPVRVVKYPFVR 358 *****...4555579******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory