Align glycolate oxidase subunit glcD (characterized)
to candidate N515DRAFT_1999 N515DRAFT_1999 D-lactate dehydrogenase
Query= CharProtDB::CH_024646 (499 letters) >FitnessBrowser__Dyella79:N515DRAFT_1999 Length = 456 Score = 261 bits (668), Expect = 3e-74 Identities = 163/456 (35%), Positives = 236/456 (51%), Gaps = 5/456 (1%) Query: 19 TSVLMALREHVPGLEILHTDEEIIPYECDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRL 78 T++L AL G + + E + Y D S P VV P EQ A++ C Sbjct: 5 TALLEALHASFAGDALSLGEAERLAYAYDN-SRRNALPDAVVFPTSHEQTEALVRACREH 63 Query: 79 RVPVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNLAISQAVA 138 RVP+V RG GT +G +P++ GV+ R IL I+P R A V+PGV N + QA+ Sbjct: 64 RVPLVARGRGTNTTGATVPVDGGVVASFERMNRILRIDPDNRLAVVEPGVLNGDLQQALK 123 Query: 139 PHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGS-D 197 PH ++ PDP+S CSIGGN+A N+ G +KYG N L + G G+ Sbjct: 124 PHGFFWPPDPTSSPWCSIGGNLACNSAGPRTVKYGSPRENTLGLRAVAGTGVGFRCGTYT 183 Query: 198 ALDSPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLAVGDIIAN 257 + S G+DL L GSEG L + TE T+KL PKP R L A++ V A AV I+A Sbjct: 184 SKGSTGYDLTRLLIGSEGTLALITEATLKLTPKPSGLRTLRATYRDVSAAARAVARIMAQ 243 Query: 258 GIIPGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVESDVQEDCERVNDILLKAG 317 + P LE +D+++++ A D PV A A+L+ E+DG + E V+ G Sbjct: 244 PVTPCALEFIDDVALKLARDHGGDSVPV-AGAMLMIEVDGEPDTLAGAVEAVSRAARGDG 302 Query: 318 ATDVRLAQDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQY 377 +++AQ E W+ RK PA ISP+ D +P LP +++GI L+ ++ Sbjct: 303 LESLQVAQSAEETQALWSARKALSPAQRTISPNKINEDVVVPVSRLPELVDGIKALAAKH 362 Query: 378 DLRVANVFHAGDGNMHPLILFDANEPGEFARAEELGGKILELCVEVGGSISGEHGIGREK 437 D+ + + HAG+GN+H +L + E RA ++ L + + G++SGEHGIG K Sbjct: 363 DVLIVSFGHAGNGNLHVNLL--PRDEAERERAHACLAEVFALVIRLDGTLSGEHGIGLVK 420 Query: 438 INQMCAQFNSDEITTFHAVKAAFDPDGLLNPGKNIP 473 M + + VKAAFDPDG+LNP K +P Sbjct: 421 REFMPLALQPETLGLMRGVKAAFDPDGILNPRKLLP 456 Lambda K H 0.320 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 456 Length adjustment: 33 Effective length of query: 466 Effective length of database: 423 Effective search space: 197118 Effective search space used: 197118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory