Align Probable lactoylglutathione lyase; EC 4.4.1.5; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase (uncharacterized)
to candidate N515DRAFT_3310 N515DRAFT_3310 lactoylglutathione lyase
Query= curated2:Q9KT93 (138 letters) >FitnessBrowser__Dyella79:N515DRAFT_3310 Length = 140 Score = 87.0 bits (214), Expect = 1e-22 Identities = 50/125 (40%), Positives = 72/125 (57%), Gaps = 7/125 (5%) Query: 5 RILHTMLRVGDLDKSIEFYTQVMGMSLLRKNENTEYKYTLAFLGYGDESQGAVIELTYNW 64 + LH+M+RV D+D S+ F+ +G+ R+ E+ K+TL +L S A +ELTYNW Sbjct: 2 KYLHSMVRVRDVDASLRFFCDGLGLQETRRMESAAGKFTLIYLA-APASPEAEVELTYNW 60 Query: 65 -GVADYEKGNAYGHIAIGVDDIYATCDTIKAAGGIVTREPGPVKGGTTHIAFVKDPDGYM 123 DY +GH+A VDDIY TC ++ G + R P + G H+AFV+ PD Sbjct: 61 DSDEDYGSARNFGHLAFEVDDIYRTCRHLQDLGYTINRPP---RDG--HMAFVRSPDLIS 115 Query: 124 IELIQ 128 IEL+Q Sbjct: 116 IELLQ 120 Lambda K H 0.317 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 72 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 138 Length of database: 140 Length adjustment: 15 Effective length of query: 123 Effective length of database: 125 Effective search space: 15375 Effective search space used: 15375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory