Align hydroxyacylglutathione hydrolase (EC 3.1.2.6) (characterized)
to candidate N515DRAFT_0434 N515DRAFT_0434 hydroxyacylglutathione hydrolase
Query= BRENDA::Q8ZRM2 (251 letters) >FitnessBrowser__Dyella79:N515DRAFT_0434 Length = 254 Score = 216 bits (551), Expect = 3e-61 Identities = 111/253 (43%), Positives = 151/253 (59%), Gaps = 3/253 (1%) Query: 1 MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVG 60 M++ +PA DNYIW+L +D G ++VDPGEAAP+ A+ AI LTHHH+DH+G Sbjct: 1 MHVVPVPALADNYIWLLYDDAGDAIVVDPGEAAPIEAALDRRGLRLRAILLTHHHNDHIG 60 Query: 61 GVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVL--GEKFTLFATPGHTLGHVCYF 118 GV +LL H P + VY P + + T V DGD + + +F + PGHT H+ Y Sbjct: 61 GVADLLAHGP-VPVYAPRDERIGHVTQAVADGDEVTIAQPSARFRVLEIPGHTRSHIAYV 119 Query: 119 SRPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSI 178 L CGDTLFS GCGRLFEGTP QM SL ++ LP + +CCAHEYT AN +FA ++ Sbjct: 120 GAGMLLCGDTLFSMGCGRLFEGTPQQMLASLDRLADLPGELKVCCAHEYTAANGRFAQTV 179 Query: 179 LPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPE 238 P ++ + + +V+ LR + Q TLPV L ER N FLR ++ D+ + Sbjct: 180 EPANAALAQRVEQVRALREQAQPTLPVALATERATNPFLRVDNHDVAQWCTRHGAAADRV 239 Query: 239 ARFAWLRSKKDTF 251 +RFA LR+ KD F Sbjct: 240 SRFAALRAAKDEF 252 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 254 Length adjustment: 24 Effective length of query: 227 Effective length of database: 230 Effective search space: 52210 Effective search space used: 52210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate N515DRAFT_0434 N515DRAFT_0434 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.4807.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-103 331.1 0.0 2.2e-103 330.9 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 N515DRAFT_0434 hydroxyacylglutat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 N515DRAFT_0434 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 330.9 0.0 2.2e-103 2.2e-103 2 248 .] 4 252 .. 3 252 .. 0.98 Alignments for each domain: == domain 1 score: 330.9 bits; conditional E-value: 2.2e-103 TIGR03413 2 iaipalsdNyiwllkdekseavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekf 67 +++pal+dNyiwll d++ +a+vvDpgea+p+ +al+++gl+l+aillTHhH+DH+ggva+ll++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 4 VPVPALADNYIWLLYDDAGDAIVVDPGEAAPIEAALDRRGLRLRAILLTHHHNDHIGGVADLLAHG 69 789*************************************************************** PP TIGR03413 68 pvkvvgpaeeripgltkevkegdevel..lelevevlevpGHtlgHiayyleeekvlFcgDtLfsa 131 pv+v++p++eri ++t++v++gdev++ +++++vle+pGHt++Hiay+ + ++l cgDtLfs+ lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 70 PVPVYAPRDERIGHVTQAVADGDEVTIaqPSARFRVLEIPGHTRSHIAYVGA--GMLLCGDTLFSM 133 ***************************5556899******************..************ PP TIGR03413 132 GCGrlfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrak 197 GCGrlfegt++qml+sl++la+Lp e kv+caHEYt++N rFa++vep+n+al++r+++v+alr++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 134 GCGRLFEGTPQQMLASLDRLADLPGELKVCCAHEYTAANGRFAQTVEPANAALAQRVEQVRALREQ 199 ****************************************************************** PP TIGR03413 198 gkptlPstlaeekatNpFLraeeaevkaalee..ekaeevevfaelRekkdkf 248 +ptlP+ la+e+atNpFLr+++++v++ +++ ++a++v+ fa+lR++kd+f lcl|FitnessBrowser__Dyella79:N515DRAFT_0434 200 AQPTLPVALATERATNPFLRVDNHDVAQWCTRhgAAADRVSRFAALRAAKDEF 252 **************************999998889999*************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (254 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.97 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory