Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate N515DRAFT_0543 N515DRAFT_0543 Glyoxylase, beta-lactamase superfamily II
Query= curated2:A5FZE9 (243 letters) >FitnessBrowser__Dyella79:N515DRAFT_0543 Length = 311 Score = 80.1 bits (196), Expect = 5e-20 Identities = 70/220 (31%), Positives = 100/220 (45%), Gaps = 37/220 (16%) Query: 26 HGGASAFVDPADAAAAIEAVEAAGGRLDWVLLTHHHDDHIAGAVDLAARFGARIA---GN 82 + A+A V A A A + V ++W+L TH H DH++ L FGA++A G Sbjct: 60 YDAAAARVSTASAEAVMAYVREQRLTVEWILETHAHADHLSAGDHLRNAFGAKLAIGEGI 119 Query: 83 AADAARLPRL--------------DAALAPGQTIDLGGEAVRMIATPGHTVGHVTYLFGD 128 +R L D+ L G + G +R++ATPGHT +TYL GD Sbjct: 120 VRVQSRFKALFGLGEEFVPDGSQFDSLLRDGDVLHAGVMQIRVLATPGHTDDGLTYLIGD 179 Query: 129 AAAACGDTLFSLGCGR----MFEGTPAQFHASLQALAALDPETLMLCGHEYTLSNARFAR 184 AA GDTLF+ G G A+ +AS+Q + AL +T + H+Y + +R Sbjct: 180 AAFV-GDTLFAPETGTARCDFPGGDAARLYASIQQILALPADTRLFLCHDYPPA----SR 234 Query: 185 HVDPDNAALAAR---------AAEAE--RLRAAGAPTLPV 213 +P ++ A R A EA LR A TLPV Sbjct: 235 GAEPQSSIEAQRQGNVHVKDGATEASFVALRTARDATLPV 274 Lambda K H 0.322 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 311 Length adjustment: 25 Effective length of query: 218 Effective length of database: 286 Effective search space: 62348 Effective search space used: 62348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory