GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mcm-large in Dyella japonica UNC79MFTsu3.2

Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate N515DRAFT_0973 N515DRAFT_0973 methylmalonyl-CoA mutase

Query= BRENDA::O74009
         (563 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0973 N515DRAFT_0973
            methylmalonyl-CoA mutase
          Length = 1155

 Score =  226 bits (576), Expect = 4e-63
 Identities = 139/371 (37%), Positives = 223/371 (60%), Gaps = 13/371 (3%)

Query: 195  LRGTVQNDILKEYIARGTYIFPPQPSMRLTTDIIMYCAEN-VPKWNPISISGYHIREAGA 253
            +RGTVQ DILKE  A+ T IF  + ++R+  DI  Y  ++ V  +  +SISGYHI EAGA
Sbjct: 788  VRGTVQADILKEDQAQNTCIFSTEFALRMMGDIQQYFVDHKVRNFYSVSISGYHIAEAGA 847

Query: 254  NAVQEVAFTLADGIEYVKAVIERGMDVDKFAPRLSFFFAAHNNFLEEIAKF-RAARRLWA 312
            N + ++AFTL++G   V+  + RGM +D FAP LSFFF+  N    E     R ARR+WA
Sbjct: 848  NPISQLAFTLSNGFTIVEYYLARGMHIDDFAPNLSFFFS--NGMDPEYTVIGRVARRIWA 905

Query: 313  YIMKEWFNAKNPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVLGGTQSLHTNSY 372
              M+E + A + RS ML++H QT+G +L AQ+ + N +R  +QAL A+     SLHTN+Y
Sbjct: 906  RAMRERYGA-SARSQMLKYHIQTSGRSLHAQEIQFNDIRTTLQALYALFDNCNSLHTNAY 964

Query: 373  DEALSLPTEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQ 432
            DEA++ PTE+SVR A+  Q II  E G+    +P  G++ ++ LTD + E   +  E I 
Sbjct: 965  DEAITTPTEESVRRAVAIQLIINRELGLNFNENPWQGSFVVDALTDLVEEAVYREFEAIS 1024

Query: 433  KMGGMMRAIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDE-----PIEVEILKV 487
            + GG++ A++  Y + +I E +  Y+++  +G   ++GVN F+  +       E+E+++ 
Sbjct: 1025 ERGGVLGAMDTMYQRGKIQEESMYYEQKKHDGSLPLIGVNTFLPKDHGGEIATEIELIRS 1084

Query: 488  DPSIREKQIERLKKLRSERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVT 547
                + +QI+ ++     R N    E+L  L+N A +E  N+   ++EA ++  +L +++
Sbjct: 1085 TEEEKGQQIDNVQAYAKAR-NGLAPESLKILQNTA-RERRNVFEQLMEAVKY-NSLGQIS 1141

Query: 548  DVLREIWGEYR 558
              L ++ GEYR
Sbjct: 1142 HALYDVGGEYR 1152



 Score = 79.3 bits (194), Expect = 8e-19
 Identities = 56/144 (38%), Positives = 78/144 (54%), Gaps = 7/144 (4%)

Query: 54  DLGEDWNYMEKLGFPGEYPFTRGVYATMYRGRIWTMRQYAGYATAEESNKRYKYLLSQG- 112
           D G+   ++ +   PG YP+T GVY     G   T R +AG  T E +N+R+ Y LSQG 
Sbjct: 580 DWGDLVRFLMRENLPGYYPYTGGVYPYRRTGEDPT-RMFAGEGTPERTNRRFHY-LSQGG 637

Query: 113 -QTGLSVAFDLPTQLGYD-SDHPLAEGEVGKVGVAIDSLWDMRILFDGIPLD--KVSTSM 168
             T LS AFD  T  G D +  P   G++G  GV + +L DM+ L+ G  L     S SM
Sbjct: 638 AATRLSTAFDSVTLYGEDPAPRPDIYGKIGNSGVNVATLDDMKKLYSGFDLSAPSSSVSM 697

Query: 169 TINSTAANLLAMYILVAEEQGVSQ 192
           TIN  A  +LAM++  A +Q + +
Sbjct: 698 TINGPAPIILAMFMNTAIDQNIEK 721


Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1311
Number of extensions: 49
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 563
Length of database: 1155
Length adjustment: 41
Effective length of query: 522
Effective length of database: 1114
Effective search space:   581508
Effective search space used:   581508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory