GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpC in Dyella japonica UNC79MFTsu3.2

Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate N515DRAFT_2064 N515DRAFT_2064 citrate synthase

Query= BRENDA::Q9I5E3
         (375 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2064 N515DRAFT_2064 citrate
           synthase
          Length = 431

 Score =  188 bits (477), Expect = 3e-52
 Identities = 120/385 (31%), Positives = 199/385 (51%), Gaps = 22/385 (5%)

Query: 11  GLRGQVAGQTALSTVGQEGAGLTYRGYDVRDLAAAAIFEEVAYLLLYGELPNKQQLDAYL 70
           G     + ++A++ +  +   L YRGY +  LA  + F E AYLLL GELP+K +   + 
Sbjct: 49  GYGSTASTKSAITYIDGDQGVLLYRGYPIEQLAEKSSFLETAYLLLNGELPSKSEFVKFE 108

Query: 71  KKLQGQRDLPQALKEVLERIPKDAHPMDVMRTG-ASVLGTLEPELSFDQQRD---VADRL 126
             +     + ++LK+  +    DAHPM ++    AS+      ++  D   D    A RL
Sbjct: 109 DDITHHTMMHESLKDFFKGFHHDAHPMAMLAASVASLSAFYHDDIDVDDAEDRKLAAIRL 168

Query: 127 LAAFPAIMTYWYRFTHEGQRIDCNSDEPTIGGHFLALLHGKKPSE------LHVKVMNVS 180
           +A  P I    +R++  G       +       FL ++  + PSE      +  K +++ 
Sbjct: 169 IAKMPTIAAACFRYSI-GWPFRYPRNNLEYVDRFLHMMF-EVPSEPLTLSPVAAKALDLL 226

Query: 181 LILYAEHEFNASTFTARVCASTLSDLYSCVTGAIGSLRGPLHGGANEAAMELIERFSSPQ 240
            IL+A+HE NAST T R+  ST ++ Y+ +   I +L GP HGGANEA ++++E   +  
Sbjct: 227 FILHADHEQNASTSTVRLVGSTGANPYASIAAGITALWGPAHGGANEAVLKMLEEIGTAD 286

Query: 241 EATAELLKMLERKD--KIMGFGHAIYKDSDPRNEVIKGWSKQLADEVG------DKVLFA 292
           +    + +  ++ D  ++MGFGH +YK+ DPR ++I+  + ++  E+G      +  L  
Sbjct: 287 KVETAVKRAKDKNDNFRLMGFGHRVYKNFDPRAKIIREMTHKVLGELGVNDPLLEVALKL 346

Query: 293 VSEAIDKTMWEQKKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRTSGWTAHVFEQR--A 350
              A+    + ++KL+PN DFY    Y  + IPT++FT +F  +RT+GW AH  EQ    
Sbjct: 347 EEAALKDDYFVERKLYPNVDFYSGIIYKALNIPTEMFTVMFAIARTAGWIAHWIEQHETP 406

Query: 351 NNRIIRPSAEYTGVEQRAFVPLEQR 375
             RI RP   YTG   R +V  ++R
Sbjct: 407 GARIGRPRQIYTGANVRDYVSADKR 431


Lambda     K      H
   0.319    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 400
Number of extensions: 22
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 375
Length of database: 431
Length adjustment: 31
Effective length of query: 344
Effective length of database: 400
Effective search space:   137600
Effective search space used:   137600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory