Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate N515DRAFT_3653 N515DRAFT_3653 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)
Query= TCDB::F2HQ25 (459 letters) >FitnessBrowser__Dyella79:N515DRAFT_3653 Length = 453 Score = 267 bits (683), Expect = 5e-76 Identities = 158/444 (35%), Positives = 240/444 (54%), Gaps = 17/444 (3%) Query: 11 QRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFFFLRTIGEMLY 70 QR L RHI +A+ IG GLFLG+ I + GPSV+FAY+ G +F +R +GEM Sbjct: 6 QRRLTPRHITFMALGMAIGAGLFLGSANAINLAGPSVLFAYLFGGAMIFIIMRALGEMAV 65 Query: 71 NDPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFWLPQVPLWLIE 130 +DP SF + +Y G GY T W+YW+++V V ++E TA+G Y++ W P++P W+ Sbjct: 66 HDPVAGSFSTYAHRYLGPFAGYLTGWNYWILMVGVGMAESTAVGIYMRQWFPELPQWIWV 125 Query: 131 IVMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHYSTVLSGKTVH 190 +A++ GLN + + +GE EFWF +IKV ++ MI+ AG G+ V Sbjct: 126 FGSVAMIGGLNLMAVKVYGEMEFWFTLIKVVTVVLMILGG----AGMIWLGWGNGGQPV- 180 Query: 191 DSASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSLPKAINQI 250 L+N++ FPHG V AL +V+FAF +E IGM A E P++++P+A+N + Sbjct: 181 ---GLANLWSHGGWFPHGFTGMVLALPVVVFAFGGIETIGMAAGEAAQPERTIPRAVNSV 237 Query: 251 PVRILLFYVGALLAIMAIFNWHYIPADKSPFVMVFQLIGIKWAAALINFVVLTSAASALN 310 RIL+FYVGAL IMAI+ W + SPFV F +GI AA LINFVV+T+A S N Sbjct: 238 LWRILIFYVGALFVIMAIYPWDQLGTQGSPFVTTFGKLGIPQAAGLINFVVITAALSGFN 297 Query: 311 SSLFSATRNMYSLAQQHDKGRLTPFT-KLSKAGIPINALYMATALSLLAPVLT-LIPQIK 368 S+ FS +R +YSL+ K + F ++S+ G+P+ A+ + A + VL L+P+ Sbjct: 298 STTFSGSRMLYSLS---TKAQAPAFLGQVSEHGVPVRAVLVTLACLVFGVVLNYLLPE-- 352 Query: 369 NAFDFAASCTTNLFLVVYFITLYTYWQYRKSEDYNPKGFLTPKPQITVPFIVAIFAIVFA 428 F S + + + L ++ +R+ + F +T + A V Sbjct: 353 RIFAMMMSILAFNTVWTWMMVLIAHYSFRRR--HGATAFPLRAWPLTSVVCLLFLAFVLF 410 Query: 429 SLFFNADTFYPALGAIVWTIFFGL 452 L ++ADT W + L Sbjct: 411 MLGYSADTRVALYVGAGWVVLLSL 434 Lambda K H 0.329 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 632 Number of extensions: 41 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 453 Length adjustment: 33 Effective length of query: 426 Effective length of database: 420 Effective search space: 178920 Effective search space used: 178920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory