Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate N515DRAFT_0039 N515DRAFT_0039 L-threonine 3-dehydrogenase
Query= BRENDA::P07913 (341 letters) >FitnessBrowser__Dyella79:N515DRAFT_0039 Length = 344 Score = 476 bits (1224), Expect = e-139 Identities = 221/340 (65%), Positives = 267/340 (78%), Gaps = 1/340 (0%) Query: 1 MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV 60 MKAL K E+GIWM +VPVPE+G N++LIK+ KTAICGTD+HIY WDEWSQ+TI + Sbjct: 5 MKALVKRLPEQGIWMEEVPVPEVGPNEVLIKMEKTAICGTDLHIYKWDEWSQRTIKPGLT 64 Query: 61 VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC 120 +GHE+VG +V IG V G+K+GDRVS EGHI CGHCRNCR GR HLC NT+G+GVNR G Sbjct: 65 IGHEFVGRIVDIGPGVTGYKVGDRVSAEGHIVCGHCRNCRAGRQHLCPNTVGIGVNRNGA 124 Query: 121 FAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA 180 FAEY+ +PA N + IPD I +LAA FDP+GNA H AL FDL+GEDVL++GAGPIGI+AA Sbjct: 125 FAEYMTMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFDLIGEDVLITGAGPIGIIAA 184 Query: 181 AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS 240 +AKHVGARNVV+TDVN+YRL+LA MG TR VNVA ++L DV+ +L + EGFDVGLEMS Sbjct: 185 GIAKHVGARNVVVTDVNDYRLKLAADMGATRVVNVANQSLRDVVKDLHI-EGFDVGLEMS 243 Query: 241 GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA 300 G P AF MLD M HGG+IA+LGI P IDW KVIFKGL ++GIYGR M+ETWYKM Sbjct: 244 GNPRAFNDMLDCMYHGGKIALLGIMPRGAGIDWDKVIFKGLTLQGIYGRRMYETWYKMTQ 303 Query: 301 LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSW 340 ++ SG L ++TH+ IDDFQKGFD M +G GKV+ SW Sbjct: 304 MVLSGFPLQKVLTHQIHIDDFQKGFDLMDAGHCGKVVCSW 343 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 344 Length adjustment: 29 Effective length of query: 312 Effective length of database: 315 Effective search space: 98280 Effective search space used: 98280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate N515DRAFT_0039 N515DRAFT_0039 (L-threonine 3-dehydrogenase)
to HMM TIGR00692 (tdh: L-threonine 3-dehydrogenase (EC 1.1.1.103))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00692.hmm # target sequence database: /tmp/gapView.28540.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00692 [M=340] Accession: TIGR00692 Description: tdh: L-threonine 3-dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-154 499.0 0.3 3.5e-154 498.8 0.3 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 N515DRAFT_0039 L-threonine 3-deh Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 N515DRAFT_0039 L-threonine 3-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 498.8 0.3 3.5e-154 3.5e-154 1 340 [] 7 343 .. 7 343 .. 0.99 Alignments for each domain: == domain 1 score: 498.8 bits; conditional E-value: 3.5e-154 TIGR00692 1 almkkkaeeGavltevpvpelgknevlikvkatsicGtdvhiynwdewaqkrikvpqvlGhevaGe 66 al+k+ +e+G+++ evpvpe+g+nevlik+++t+icGtd+hiy+wdew+q++ik+ +Ghe++G lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 7 ALVKRLPEQGIWMEEVPVPEVGPNEVLIKMEKTAICGTDLHIYKWDEWSQRTIKPGLTIGHEFVGR 72 79999************************************************************* PP TIGR00692 67 vvgiGeevegvkvGdyvsaethivcGkcvacrrGkshvcrntkivGvdtaGvfaeyvvvpadnifk 132 +v+iG++v g kvGd+vsae+hivcG+c++cr+G++h+c nt+++Gv+++G+faey+ +pa+n++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 73 IVDIGPGVTGYKVGDRVSAEGHIVCGHCRNCRAGRQHLCPNTVGIGVNRNGAFAEYMTMPASNLWP 138 ****************************************************************** PP TIGR00692 133 npkdidpelaaiqeplGnavdtvlesdlaGesvlvsGaGpiGllavavakaaGasqvivsdkneyr 198 +p++i+ elaa ++p+Gna + +le+dl Ge+vl++GaGpiG++a+ +ak++Ga++v+v+d+n+yr lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 139 IPDQIPSELAAFFDPYGNAAHCALEFDLIGEDVLITGAGPIGIIAAGIAKHVGARNVVVTDVNDYR 204 ****************************************************************** PP TIGR00692 199 lelakkvGatrvvnvakedlvkvvaeltsgeGvdvvlelsGapkaleqgldavangGrvallglpe 264 l+la +Gatrvvnva++ l +vv +l eG+dv+le+sG+p+a++++ld + +gG++allg+ + lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 205 LKLAADMGATRVVNVANQSLRDVVKDLH-IEGFDVGLEMSGNPRAFNDMLDCMYHGGKIALLGIMP 269 **************************96.69*********************************** PP TIGR00692 265 skvtidltnkvifkgltikGitGrklfetwykvsrliqsnkldlapiithkfkldefekgfelmrs 330 id+ kvifkglt++Gi+Gr+++etwyk+++++ s ++ l+ ++th+ ++d+f+kgf+lm + lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 270 RGAGIDWD-KVIFKGLTLQGIYGRRMYETWYKMTQMVLS-GFPLQKVLTHQIHIDDFQKGFDLMDA 333 *******9.******************************.89************************ PP TIGR00692 331 GksGkvilil 340 G++Gkv+ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_0039 334 GHCGKVVCSW 343 ******9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory