Align predicted periplasmic 3-ketoglycoside hydrolase (DUF1080) (characterized)
to candidate N515DRAFT_1317 N515DRAFT_1317 protein of unknown function (DUF1080)
Query= reanno::Pedo557:CA265_RS22975 (260 letters) >FitnessBrowser__Dyella79:N515DRAFT_1317 Length = 260 Score = 319 bits (818), Expect = 3e-92 Identities = 157/259 (60%), Positives = 188/259 (72%), Gaps = 4/259 (1%) Query: 3 KYTLLFIP-ALFAGQAMAQDKKPDPAKDPKTTEVWEPVPKVVTPGKLPQDAPSDATILFG 61 + L +P AL G AMAQ+ P A DPK TE WEPVP VVTPG+ PSDA +LF Sbjct: 4 RLALALLPFALATGVAMAQNAPP--AGDPKATEQWEPVPPVVTPGQRDAAPPSDAIVLFD 61 Query: 62 GRNLDAWHSVKDPSKPAEWTIDDGFFTVKKGTGNIETNKKFTDYQLHMEWKIPENISGEG 121 G LD W + KD S PA W + DG TV K TGNI+T ++F +YQLH+EW++P+NISGEG Sbjct: 62 GHQLDQWEASKDHS-PAHWKVHDGVMTVDKTTGNIQTKRRFRNYQLHLEWQVPKNISGEG 120 Query: 122 QARGNSGVFLASTGGGDNGYEIQIMDAYNNKTYVNGQTGSVYKQAIPLANANKKPGEWQY 181 QARGNSGVF+ASTG GD GYE+QI+D+Y NKTYVNGQ ++YKQ PLANA + PGEWQ Sbjct: 121 QARGNSGVFVASTGPGDEGYEVQILDSYRNKTYVNGQAAAIYKQTPPLANAMRPPGEWQA 180 Query: 182 YDIIWNAPRFNEDGTVQKPASVTVFLNGVLLQNGFVLKGETRYIGAPEYKKHGPSSIKLQ 241 YDI+W AP F DG+VQ PA VT+F NG+++QN L GET YIG P YK + + IKLQ Sbjct: 181 YDIVWTAPVFAADGSVQSPAYVTLFHNGIVVQNHTRLTGETLYIGKPVYKAYTDAPIKLQ 240 Query: 242 DHGDPSPAISYRNIWVREL 260 HGDPS IS+RNIWVR L Sbjct: 241 AHGDPSAPISFRNIWVRPL 259 Lambda K H 0.314 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory