Align glucose transporter, periplasmic substrate-binding component (characterized)
to candidate N515DRAFT_3231 N515DRAFT_3231 xylose-binding protein
Query= reanno::Phaeo:GFF3639 (341 letters) >FitnessBrowser__Dyella79:N515DRAFT_3231 Length = 341 Score = 212 bits (540), Expect = 1e-59 Identities = 123/331 (37%), Positives = 192/331 (58%), Gaps = 14/331 (4%) Query: 5 SGVSALAFAATASMAFAEDVTVGVSWSNFQEERWKTDEAAIKAALEAKGATYVSADAQSS 64 +G++ A A + A ++ +G S + + ERW D AA E GA A + Sbjct: 15 TGLAVAALTACSGKA-SDQPKIGFSIDDMRLERWTRDRDYFVAAAEKLGAKVYVQSADGN 73 Query: 65 SAKQLSDIESLIAQGVDALIVLAQDAQAIGPAVQAAADEGIPVVAYDRLIEDGRA-FYLT 123 +Q+ +E+LI++GV+ L+++ +++ + + A GI V++YDRLI Y++ Sbjct: 74 EQRQVQQLENLISRGVNVLVIVPFNSKVLDNVIAEAKRNGIKVISYDRLILGADVDAYIS 133 Query: 124 FDNVEVGRMQARAVLEAQPSGNYVMIKGSPTDPNADFLRGGQQEIIQAAIDSGDIKIVGE 183 FDN +VG +QA+ VL+A P GNY ++ GSPTD NA LR GQ +++Q AID GD+KIVG+ Sbjct: 134 FDNEKVGELQAQGVLDAVPKGNYFLLGGSPTDNNAKILREGQLKVLQPAIDRGDVKIVGQ 193 Query: 184 AYTDGWLPANAQRNMEQILTANDNKVDAVVASNDGTAGGVVAALTAQGMEG-IAVSGQDG 242 +T W + A R +E LTAN N + +VASND TAGG + AL AQ + G +AVSGQD Sbjct: 194 QWTPEWDASKALRIVEDALTANHNDIQGIVASNDATAGGAIQALAAQQLAGKVAVSGQDA 253 Query: 243 DHAALNRVAKGTQTVSVWKDARDLGKAAANIAVEMAEG---AVMGDVAGGAAWTSPAGTE 299 D A + RV GTQ ++V+K + + AA +AV++A+G G + G + Sbjct: 254 DLAGVRRVVDGTQAMTVYKPLKTIATTAAELAVKLAKGEAPTYTGKMNNGK-------KD 306 Query: 300 LTARFLEPIPVTADNL-SVVVDAGWITKEAL 329 + + L+P +T D + V+ G+ T+E + Sbjct: 307 VDSVLLQPTLLTKDKVDDTVIKDGFYTREQI 337 Lambda K H 0.313 0.128 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 341 Length adjustment: 29 Effective length of query: 312 Effective length of database: 312 Effective search space: 97344 Effective search space used: 97344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory