Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= uniprot:P70970 (276 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 120 bits (301), Expect = 4e-32 Identities = 75/216 (34%), Positives = 125/216 (57%), Gaps = 6/216 (2%) Query: 9 ALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNKDLK 68 AL + I +G +IGH+G+GKSTL++ +N L +P+ G I + T + A + L+ Sbjct: 20 ALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILIDGTEMTA-LGDAALR 78 Query: 69 KLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAR--EMLQLVGLSEELL 126 R+++G++FQ + L +TV +I+F P+ + + + KAR E+L+ VGL E Sbjct: 79 AQRRRIGMIFQH-FNLLSSQTVADNIAF-PLRLAGETDAGKIKARVDELLRRVGL-EAHA 135 Query: 127 DRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGNLTT 186 + P +LSGGQ +RV IA LA P +L+ DE T+ LDP+ ++++ E+++ LT Sbjct: 136 SKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDPQTTASVLELLAEINRELKLTI 195 Query: 187 ILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFL 222 +L+TH M+ D + V+ G I G+ D+FL Sbjct: 196 VLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFL 231 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 336 Length adjustment: 27 Effective length of query: 249 Effective length of database: 309 Effective search space: 76941 Effective search space used: 76941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory