Align Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 (characterized)
to candidate N515DRAFT_3776 N515DRAFT_3776 Kynureninase
Query= SwissProt::Q9CXF0 (464 letters) >FitnessBrowser__Dyella79:N515DRAFT_3776 Length = 428 Score = 363 bits (932), Expect = e-105 Identities = 192/421 (45%), Positives = 258/421 (61%), Gaps = 24/421 (5%) Query: 34 DEEDKLSHFRNCFYIPKMRDLPSIDLSLVSEDDDAIYFLGNSLGLQPKMVRTYLEEELDK 93 D D L FR+ F IP + + YF GNSLGLQP+ VR L ELD Sbjct: 16 DAADPLRAFRDEFLIPP------------HDGRASHYFCGNSLGLQPRAVREALTAELDD 63 Query: 94 WAKMGAYGHDVGKRPWIVGDESIVSLMKDIVGAHEKEIALMNALTINLHLLLLSFFKPTP 153 W + GH G++PW+ E + + ++VGA E+ MN L +NLHL+++SF++PTP Sbjct: 64 WGALAVEGHFKGRQPWLDYHEYVRDDLAELVGALPSEVVAMNTLGVNLHLMMVSFYRPTP 123 Query: 154 KRHKILLEAKAFPSDHYAIESQIQLHGLDVEKSMRMVKPREGEETLRMEDILEVIEEEGD 213 RH IL+EA AFP+D YA+ESQI+ HG S+ ++P E TL M I + E G+ Sbjct: 124 DRHAILIEAGAFPTDRYAVESQIRFHGFSPTLSLIELEPDEPNGTLSMGAIERALAEHGE 183 Query: 214 SIAVILFSGLHFYTGQLFNIPAITKAGHAKGCFVGFDLAHAVGNVELRLHDWGVDFACWC 273 IA++L G+ + TGQ F++ AIT H +GC VGFDLAHAVGN+ LRLHD G DFA WC Sbjct: 184 RIALVLLPGVQYRTGQAFDLKAITGLAHRQGCTVGFDLAHAVGNLPLRLHDSGADFAVWC 243 Query: 274 SYKYLNSGAGGLAGAFVHEKHAHTVK-PALVGWFGHDLSTRFNMDNKLQLIPGANGFRIS 332 SYKYLNSG G +AGAFVH++HA T P GW+GHD +RF M + PGA+G++IS Sbjct: 244 SYKYLNSGPGAVAGAFVHDRHARTEHLPRFAGWWGHDKQSRFRMGPEFVPTPGADGWQIS 303 Query: 333 NPPILLVCSLHASLEVFQQATMTALRRKSILLTGYLEYMLKHYHSKDNTENKGPIVNIIT 392 NPPIL + L SL++F +A M LR KS+ LTGYLE++++ ++ +T Sbjct: 304 NPPILSLAPLRVSLQIFHRAGMARLREKSLRLTGYLEWLVQ--------TQLADVLESVT 355 Query: 393 PSRAEERGCQLTLTFSIPK---KSVFKELEKRGVVCDKREPDGIRVAPVPLYNSFHDVYK 449 P E RG QL+L + +++F+ L + GVV D REPD IR++P PLYN F D Sbjct: 356 PRETERRGSQLSLRVLGGRERGRALFEYLMEHGVVGDWREPDVIRISPAPLYNRFEDCVG 415 Query: 450 F 450 F Sbjct: 416 F 416 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 428 Length adjustment: 32 Effective length of query: 432 Effective length of database: 396 Effective search space: 171072 Effective search space used: 171072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate N515DRAFT_3776 N515DRAFT_3776 (Kynureninase)
to HMM TIGR01814 (kynU: kynureninase (EC 3.7.1.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01814.hmm # target sequence database: /tmp/gapView.10783.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01814 [M=400] Accession: TIGR01814 Description: kynureninase: kynureninase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-144 467.9 0.0 1.5e-144 467.7 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 N515DRAFT_3776 Kynureninase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 N515DRAFT_3776 Kynureninase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 467.7 0.0 1.5e-144 1.5e-144 2 399 .. 13 424 .. 12 425 .. 0.97 Alignments for each domain: == domain 1 score: 467.7 bits; conditional E-value: 1.5e-144 TIGR01814 2 ealdaadelkalRdeFalpkakdeneviyldNSLalmpkaakealkeeldkWakllveshevgkap 67 +a daad+l+a+RdeF +p +++ ++ +NSL+l+p+a++eal +eld+W++l+ve+h+ g++p lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 13 RAQDAADPLRAFRDEFLIPPHDGRASHYFCGNSLGLQPRAVREALTAELDDWGALAVEGHFKGRQP 78 678*************************************************************** PP TIGR01814 68 Wleldealeklla..lvakekevvvmnsltvNlhkllasfykptekRakIlleakaFPsDlyaies 131 Wl+++e++++ la ++a +evv+mn+l vNlh++++sfy+pt++R++Il+ea aFP+D+ya+es lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 79 WLDYHEYVRDDLAelVGALPSEVVAMNTLGVNLHLMMVSFYRPTPDRHAILIEAGAFPTDRYAVES 144 ********988777999************************************************* PP TIGR01814 132 qlklk.leveeslvqvepre.eetlrledildviekeqdeiAlvllsgvqYkt.qlfdlaaitkaa 194 q++ + ++ sl+++ep+e ++tl++ +i+ ++++++++iAlvll+gvqY+t q+fdl+ait +a lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 145 QIRFHgFSPTLSLIELEPDEpNGTLSMGAIERALAEHGERIALVLLPGVQYRTgQAFDLKAITGLA 210 ****************************************************************** PP TIGR01814 195 rkkgalvvfDLaHava.vpleLhdwdvDfAvwCsYKylnasp.a.agafvhekkakee.lprlalw 256 +++g+ v+fDLaHav+ +pl+Lhd ++DfAvwCsYKyln++p a agafvh+++a++e lpr+a+w lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 211 HRQGCTVGFDLAHAVGnLPLRLHDSGADFAVWCSYKYLNSGPgAvAGAFVHDRHARTEhLPRFAGW 276 ******************************************877*********9765279***** PP TIGR01814 257 wwhekskrfkmeeklelrp..aafrlsnppvlsvaalka.LelfdqaslealRkkSllLTdyleeL 319 w+h+k++rf+m +++++p ++++snpp+ls+a+l+ L++f+ a ++ lR+kSl LT+yle L lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 277 WGHDKQSRFRMGPEFVPTPgaDGWQISNPPILSLAPLRVsLQIFHRAGMARLREKSLRLTGYLEWL 342 *******************999****************99************************** PP TIGR01814 320 vkarlayklvleiitPedtaer.sqlslkfs...kedkavlkalkkrdvviDkRePnviRlaPvpL 381 v+++la vle +tP++t++r sqlsl++ + +a++++l++++vv D+ReP+viR+ P+pL lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 343 VQTQLAD--VLESVTPRETERRgSQLSLRVLggrERGRALFEYLMEHGVVGDWREPDVIRISPAPL 406 ******6..9********************88878899**************************** PP TIGR01814 382 YntfkDvykavevleeil 399 Yn+f+D + e+++ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3776 407 YNRFEDCVGFAEAVRAWA 424 *********999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (400 nodes) Target sequences: 1 (428 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.13 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory